£€0€ €0€ €0€ €yu¡€0€ €1XD1¡€remark 3: Refinement.¡€remark 3: Program : Cns¡€Aremark 3: Authors : Brunger,Adams,Clore,Delano,Gros,Grosse-¡€6remark 3: : Kunstleve,Jiang,Kuszewski,Nilges, Pannu,¡€'remark 3: : Read,Rice,Simonson,Warren¡€,remark 3: Refinement Target : Engh & Huber¡€$remark 3: Data Used In Refinement.¡€4remark 3: Resolution Range High (Angstroms) : 2.20¡€5remark 3: Resolution Range Low (Angstroms) : 10.00¡€5remark 3: Data Cutoff (Sigma(F)) : 0.000¡€4remark 3: Data Cutoff High (Abs(F)) : Null¡€4remark 3: Data Cutoff Low (Abs(F)) : Null¡€4remark 3: Completeness (Working+test) (%) : Null¡€5remark 3: Number Of Reflections : 24648¡€+remark 3: Fit To Data Used In Refinement.¡€3remark 3: Cross-Validation Method : Null¡€5remark 3: Free R Value Test Set Selection : Random¡€4remark 3: R Value (Working Set) : 0.186¡€4remark 3: Free R Value : 0.203¡€3remark 3: Free R Value Test Set Size (%) : Null¡€3remark 3: Free R Value Test Set Count : 1195¡€3remark 3: Estimated Error Of Free R Value : Null¡€.remark 3: Fit In The Highest Resolution Bin.¡€6remark 3: Total Number Of Bins Used : Null¡€6remark 3: Bin Resolution Range High (A) : Null¡€6remark 3: Bin Resolution Range Low (A) : Null¡€6remark 3: Bin Completeness (Working+test) (%) : Null¡€6remark 3: Reflections In Bin (Working Set) : Null¡€6remark 3: Bin R Value (Working Set) : Null¡€6remark 3: Bin Free R Value : Null¡€6remark 3: Bin Free R Value Test Set Size (%) : Null¡€6remark 3: Bin Free R Value Test Set Count : Null¡€6remark 3: Estimated Error Of Bin Free R Value : Null¡€remark 3: Group 1 Positional (A) : Null ; Null¡€remark 200: Experiment Type : X-Ray Diffraction¡€8remark 200: Date Of Data Collection : 19-May-2002¡€2remark 200: Temperature (Kelvin) : 100.0¡€1remark 200: Ph : 7.50¡€.remark 200: Number Of Crystals Used : 1¡€-remark 200: Synchrotron (YN) : N¡€;remark 200: Radiation Source : Rotating Anode¡€1remark 200: Beamline : Null¡€9remark 200: X-Ray Generator Model : Rigaku Ru300¡€-remark 200: Monochromatic Or Laue (ML) : M¡€3remark 200: Wavelength Or Range (A) : 1.5418¡€4remark 200: Monochromator : Mirrors¡€1remark 200: Optics : Null¡€8remark 200: Detector Type : Image Plate¡€8remark 200: Detector Manufacturer : Marresearch¡€2remark 200: Intensity-Integration Software : Denzo¡€6remark 200: Data Scaling Software : Scalepack¡€2remark 200: Number Of Unique Reflections : 24648¡€2remark 200: Resolution Range High (A) : 2.200¡€3remark 200: Resolution Range Low (A) : 10.000¡€2remark 200: Rejection Criteria (Sigma(I)) : 3.000¡€remark 200: Overall.¡€1remark 200: Completeness For Range (%) : 99.0¡€1remark 200: Data Redundancy : Null¡€1remark 200: R Merge (I) : Null¡€1remark 200: R Sym (I) : Null¡€0remark 200: FOR THE DATA SET : NULL¡€,remark 200: In The Highest Resolution Shell.¡€;remark 200: Highest Resolution Shell, Range High (A) : 2.20¡€;remark 200: Highest Resolution Shell, Range Low (A) : 2.28¡€1remark 200: Completeness For Shell (%) : 98.4¡€1remark 200: Data Redundancy In Shell : Null¡€1remark 200: R Merge For Shell (I) : Null¡€1remark 200: R Sym For Shell (I) : Null¡€0remark 200: FOR SHELL : NULL¡€3remark 200: Diffraction Protocol: Single Wavelength¡€Iremark 200: Method Used To Determine The Structure: Molecular Replacement¡€remark 200: Software Used: Cns¡€ remark 200: Starting Model: Null¡€remark 200: Remark: Null¡€remark 280: Crystal¡€,remark 280: Solvent Content, Vs (%): 44.86¡€9remark 280: Matthews Coefficient, Vm (Angstroms3DA): 2.23¡€Iremark 280: Crystallization Conditions: 2-Methylpentane-2,4-Diol, Ph 7.5,¡€;remark 280: Vapor Diffusion, Hanging Drop, Temperature 298k¡€%remark 290: Crystallographic Symmetry¡€:remark 290: Symmetry Operators For Space Group: P 21 21 21¡€remark 290: Symop Symmetry¡€remark 290: Nnnmmm Operator¡€remark 290: 1555 X,Y,Z¡€remark 290: 2555 12-X,-Y,12+Z¡€remark 290: 3555 -X,12+Y,12-Z¡€remark 290: 4555 12+X,12-Y,-Z¡€(remark 290: Where Nnn -> Operator Number¡€%remark 290: Mmm -> Translation Vector¡€5remark 290: Crystallographic Symmetry Transformations¡€Cremark 290: The Following Transformations Operate On The AtomHETATM¡€Aremark 290: Records In This Entry To Produce Crystallographically¡€remark 290: Related Molecules.¡€Cremark 290: Smtry1 1 1.000000 0.000000 0.000000 0.00000¡€Cremark 290: Smtry2 1 0.000000 1.000000 0.000000 0.00000¡€Cremark 290: Smtry3 1 0.000000 0.000000 1.000000 0.00000¡€Cremark 290: Smtry1 2 -1.000000 0.000000 0.000000 26.35000¡€Cremark 290: Smtry2 2 0.000000 -1.000000 0.000000 0.00000¡€Cremark 290: Smtry3 2 0.000000 0.000000 1.000000 66.15000¡€Cremark 290: Smtry1 3 -1.000000 0.000000 0.000000 0.00000¡€Cremark 290: Smtry2 3 0.000000 1.000000 0.000000 34.50000¡€Cremark 290: Smtry3 3 0.000000 0.000000 -1.000000 66.15000¡€Cremark 290: Smtry1 4 1.000000 0.000000 0.000000 26.35000¡€Cremark 290: Smtry2 4 0.000000 -1.000000 0.000000 34.50000¡€Cremark 290: Smtry3 4 0.000000 0.000000 -1.000000 0.00000¡€remark 290: Remark: Null¡€remark 300: Biomolecule: 1¡€Dremark 300: This Entry Contains The Crystallographic Asymmetric Unit¡€remark 500: Than 6Rmsd (Mmodel Number; Resresidue Name; Cchain¡€>remark 500: Identifier; Sseqsequence Number; Iinsertion Code).¡€remark 500: Standard Table:¡€?remark 500: Format: (10x,I3,1x,2(A3,1x,A1,I4,A1,1x,A4,3x),F6.3)¡€1remark 500: Expected Values: Engh And Huber, 1991¡€;remark 500: M Res Csseqi Atm1 Res Csseqi Atm2 Deviation¡€6remark 500: Asn A 459 C Gly A 460 N 0.051¡€6remark 500: Asn A 461 Cb Asn A 461 Cg -0.062¡€6remark 500: Asn A 461 Cg Asn A 461 Nd2 -0.072¡€(remark 500: Geometry And Stereochemistry¡€*remark 500: Subtopic: Covalent Bond Angles¡€Cremark 500: The Stereochemical Parameters Of The Following Residues¡€Bremark 500: Have Values Which Deviate From Expected Values By More¡€>remark 500: Than 6Rmsd (Mmodel Number; Resresidue Name; Cchain¡€>remark 500: Identifier; Sseqsequence Number; Iinsertion Code).¡€remark 500: Standard Table:¡€Cremark 500: Format: (10x,I3,1x,A3,1x,A1,I4,A1,3(1x,A4,2x),12x,F5.1)¡€1remark 500: Expected Values: Engh And Huber, 1991¡€+remark 500: M Res Csseqi Atm1 Atm2 Atm3¡€Bremark 500: Thr A 11 N - Ca - C Angl. Dev. 9.2 Degrees¡€Bremark 500: Gly A 36 N - Ca - C Angl. Dev. 9.6 Degrees¡€Bremark 500: Gln A 41 N - Ca - C Angl. Dev. -9.5 Degrees¡€Bremark 500: Met A 102 N - Ca - C Angl. Dev. -8.4 Degrees¡€Bremark 500: Gly A 164 N - Ca - C Angl. Dev. 8.3 Degrees¡€Bremark 500: Arg A 195 N - Ca - C Angl. Dev. -11.1 Degrees¡€Bremark 500: Asn A 216 N - Ca - C Angl. Dev. -8.5 Degrees¡€Bremark 500: Val A 234 N - Ca - C Angl. Dev. -8.3 Degrees¡€Bremark 500: Leu A 293 N - Ca - C Angl. Dev. -13.1 Degrees¡€Bremark 500: Ala A 318 N - Ca - C Angl. Dev. 8.8 Degrees¡€Bremark 500: Gly A 334 N - Ca - C Angl. Dev. 9.3 Degrees¡€Bremark 500: Thr A 336 N - Ca - C Angl. Dev. 9.4 Degrees¡€Bremark 500: Asp A 451 N - Ca - C Angl. Dev. -8.8 Degrees¡€Bremark 500: Lys A 457 N - Ca - C Angl. Dev. -9.5 Degrees¡€remark 900: Related Entries¡€.remark 900: Related Id: 1xcw Related Db: Pdb¡€.remark 900: Related Id: 1xcx Related Db: Pdb¡€.remark 900: Related Id: 1xd0 Related Db: Pdb¡€CDbref 1xd1 A 1 496 Sws P04746 Amyp_human 16 511¡€ASeqadv 1xd1 Pca A 1 Sws P04746 Gln 16 Modified Residue¡€.Modres 1xd1 Pca A 1 Glu Pyroglutamic Acid¡€/Modres 1xd1 Asn A 461 Asn Glycosylation Site¡€8Link Nd2 Asn A 461 C1 Nag 499¡€;Cispep 1 Asn A 53 Pro A 54 0 0.14¡€;Cispep 2 Val A 129 Pro A 130 0 -0.12£€0€¢€0€ €Protein Data Bank¡€ €¡€0€ €Ô¡€ ¢€¢€¡€0€ €PDB¡€¡€1XD1£€¡€0€ €Ô¡€ ¢€¤€¡€0€ €0€ € €0€0€ €¡€0€ €Li£€C.Li¤€C.0€ €¡€0€ €Begum£€A.Begum¤€A.0€ €¡€0€ €Numao£€S.Numao¤€S.0€ €¡€0€ €Park£€K.H.Park¤€K.H.0€ €¡€0€ €Withers£€ S.G.Withers¤€S.G.0€ €¡€0€ €Brayer£€ G.D.Brayer¤€G.D.¡€0€ €¡€0€ €Ô¡€ ¢€¤€¤€0€ €1€ €¬Acarbose Rearrangement Mechanism Implied By The Kinetic And Structural Analysis Of Human Pancreatic Alpha-Amylase In Complex With Analogues And Their Elongated Counterparts¡€0€ € €0€0€ €¡€0€ €Li£€C.Li¤€C.0€ €¡€0€ €Begum£€A.Begum¤€A.0€ €¡€0€ €Numao£€S.Numao¤€S.0€ €¡€0€ €Park£€K.H.Park¤€K.H.0€ €¡€0€ €Withers£€ S.G.Withers¤€S.G.0€ €¡€0€ €Brayer£€ G.D.Brayer¤€G.D.¢€ €0€ €1€£€ Biochemistry¡€0€ €¡€0€ €Ô¢€0€ €0€ €¬Acarbose Rearrangement Mechanism Implied By The Kinetic And Structural Analysis Of Human Pancreatic Alpha-Amylase In Complex With Analogues And Their Elongated Counterparts¡€ Hydrolase¢€–Mol_id: 1; Organism_scientific: Homo Sapiens; Organism_common: Human; Gene: Amy2a; Expression_system: Pichia Pastoris; Expression_system_common: Fungi£€‚¾Acarbose Rearrangement Mechanism Implied By The Kinetic And Structural Analysis Of Human Pancreatic Alpha-Amylase In Complex With Analogues And Their Elongated Counterparts Amylase, Acarbose, Acarbose Analogues, Inhibitor, Acarviosine, Isoacarbose, Structure, Enzyme, Catalysis, Enzyme Mechanism Mol_id: 1; Molecule: Alpha-Amylase; Chain: A; Synonym: 1,4-Alpha-D-Glucan Glucanohydrolase, Pancreatic Alpha-Amylase, Pa; Ec: 3.2.1.1; Engineered: Yes§€ÿ¡€0€0€ €¡€0€ €A£€SEQRES¨€¥€0€¢€0€ € Homo sapiens¡€human£€1€0€ €taxon¡€ €%†¥€0€ € €0€ €Homo¡€sapiens£€{Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Primates; Catarrhini; Hominidae; Homo¤€¥€¦€PRI¢€«€w·&£€0€0€ €¡€ 1 ¢€ €0€ €¡€ 2 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €¡€ 3 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €¡€ 4 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €¡€ 5 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 6 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €¡€ 7 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 8 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ € ¡€ 9 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ € ¡€ 10 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ € ¡€ 11 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ € ¡€ 12 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ € ¡€ 13 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 14 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €¡€ 15 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 16 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 17 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €¡€ 18 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 19 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€40€ €¡€ 20 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 21 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€40€ €¡€ 22 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €¡€ 23 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €¡€ 24 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 25 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 26 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 27 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 28 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €¡€ 29 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 30 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 31 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ € ¡€ 32 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €!¡€ 33 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €"¡€ 34 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €#¡€ 35 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €$¡€ 36 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €%¡€ 37 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €&¡€ 38 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €'¡€ 39 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €(¡€ 40 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €)¡€ 41 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €*¡€ 42 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €+¡€ 43 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €,¡€ 44 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €-¡€ 45 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €.¡€ 46 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €/¡€ 47 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €0¡€ 48 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €1¡€ 49 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €2¡€ 50 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €3¡€ 51 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €4¡€ 52 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €5¡€ 53 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €6¡€ 54 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €7¡€ 55 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €8¡€ 56 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €9¡€ 57 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €:¡€ 58 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€40€ €;¡€ 59 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€40€ €<¡€ 60 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €=¡€ 61 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €>¡€ 62 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €?¡€ 63 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €@¡€ 64 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €A¡€ 65 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €B¡€ 66 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €C¡€ 67 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €D¡€ 68 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €E¡€ 69 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €F¡€ 70 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €G¡€ 71 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €H¡€ 72 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €I¡€ 73 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €J¡€ 74 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €K¡€ 75 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €L¡€ 76 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €M¡€ 77 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €N¡€ 78 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €O¡€ 79 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €P¡€ 80 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €Q¡€ 81 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €R¡€ 82 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€%0€ €S¡€ 83 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €T¡€ 84 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €U¡€ 85 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €V¡€ 86 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €W¡€ 87 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €X¡€ 88 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €Y¡€ 89 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €Z¡€ 90 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €[¡€ 91 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €\¡€ 92 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €]¡€ 93 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €^¡€ 94 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €_¡€ 95 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €`¡€ 96 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €a¡€ 97 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €b¡€ 98 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €c¡€ 99 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €d¡€ 100 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €e¡€ 101 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €f¡€ 102 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€%0€ €g¡€ 103 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €h¡€ 104 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €i¡€ 105 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €j¡€ 106 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €k¡€ 107 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €l¡€ 108 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €m¡€ 109 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €n¡€ 110 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €o¡€ 111 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €p¡€ 112 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €q¡€ 113 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €r¡€ 114 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €s¡€ 115 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €t¡€ 116 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €u¡€ 117 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €v¡€ 118 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €w¡€ 119 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €x¡€ 120 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €y¡€ 121 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €z¡€ 122 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €{¡€ 123 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €|¡€ 124 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €}¡€ 125 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €~¡€ 126 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €¡€ 127 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €€¡€ 128 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 129 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €‚¡€ 130 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €ƒ¡€ 131 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €„¡€ 132 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €…¡€ 133 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €†¡€ 134 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€40€ €‡¡€ 135 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €ˆ¡€ 136 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €‰¡€ 137 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €Š¡€ 138 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €‹¡€ 139 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €Œ¡€ 140 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €¡€ 141 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €Ž¡€ 142 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €¡€ 143 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €¡€ 144 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €‘¡€ 145 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €’¡€ 146 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €“¡€ 147 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €”¡€ 148 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €•¡€ 149 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €–¡€ 150 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €—¡€ 151 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €˜¡€ 152 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €™¡€ 153 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €š¡€ 154 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €›¡€ 155 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €œ¡€ 156 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 157 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €ž¡€ 158 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €Ÿ¡€ 159 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ € ¡€ 160 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €¡¡€ 161 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¢¡€ 162 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €£¡€ 163 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €¤¡€ 164 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¥¡€ 165 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¦¡€ 166 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €§¡€ 167 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €¨¡€ 168 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €©¡€ 169 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €ª¡€ 170 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €«¡€ 171 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¬¡€ 172 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €­¡€ 173 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €®¡€ 174 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €¯¡€ 175 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €°¡€ 176 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €±¡€ 177 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €²¡€ 178 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €³¡€ 179 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €´¡€ 180 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €µ¡€ 181 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¶¡€ 182 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €·¡€ 183 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€%0€ €¸¡€ 184 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¹¡€ 185 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €º¡€ 186 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €»¡€ 187 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¼¡€ 188 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €½¡€ 189 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¾¡€ 190 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¿¡€ 191 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €À¡€ 192 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €Á¡€ 193 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 194 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €á€ 195 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €Ä¡€ 196 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €Å¡€ 197 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €Æ¡€ 198 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €Ç¡€ 199 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €È¡€ 200 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €É¡€ 201 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €Ê¡€ 202 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€%0€ €Ë¡€ 203 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€40€ €Ì¡€ 204 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €Í¡€ 205 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €Ρ€ 206 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €Ï¡€ 207 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €С€ 208 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €Ñ¡€ 209 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €Ò¡€ 210 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €Ó¡€ 211 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €Ô¡€ 212 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €Õ¡€ 213 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €Ö¡€ 214 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €ס€ 215 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €Ø¡€ 216 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €Ù¡€ 217 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €Ú¡€ 218 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €Û¡€ 219 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €Ü¡€ 220 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €Ý¡€ 221 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€40€ €Þ¡€ 222 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €ß¡€ 223 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €à¡€ 224 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €á¡€ 225 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €â¡€ 226 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €ã¡€ 227 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €ä¡€ 228 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €å¡€ 229 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €æ¡€ 230 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €ç¡€ 231 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €è¡€ 232 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €é¡€ 233 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €ê¡€ 234 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €ë¡€ 235 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €ì¡€ 236 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €í¡€ 237 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €î¡€ 238 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €ï¡€ 239 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €ð¡€ 240 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €ñ¡€ 241 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €ò¡€ 242 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €ó¡€ 243 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €ô¡€ 244 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €õ¡€ 245 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €ö¡€ 246 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €÷¡€ 247 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €ø¡€ 248 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €ù¡€ 249 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €ú¡€ 250 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €û¡€ 251 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €ü¡€ 252 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €ý¡€ 253 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €þ¡€ 254 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €ÿ¡€ 255 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 256 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €¡€ 257 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €¡€ 258 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €¡€ 259 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 260 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 261 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €¡€ 262 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 263 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 264 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ € ¡€ 265 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ € ¡€ 266 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ € ¡€ 267 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ € ¡€ 268 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ € ¡€ 269 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€40€ €¡€ 270 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 271 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 272 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 273 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €¡€ 274 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€%0€ €¡€ 275 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €¡€ 276 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €¡€ 277 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 278 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €¡€ 279 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 280 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€40€ €¡€ 281 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 282 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 283 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 284 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€40€ €¡€ 285 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 286 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €¡€ 287 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ € ¡€ 288 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €!¡€ 289 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €"¡€ 290 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €#¡€ 291 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €$¡€ 292 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €%¡€ 293 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €&¡€ 294 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €'¡€ 295 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €(¡€ 296 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €)¡€ 297 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €*¡€ 298 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €+¡€ 299 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €,¡€ 300 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €-¡€ 301 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €.¡€ 302 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €/¡€ 303 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €0¡€ 304 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €1¡€ 305 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €2¡€ 306 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €3¡€ 307 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €4¡€ 308 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €5¡€ 309 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €6¡€ 310 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €7¡€ 311 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €8¡€ 312 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €9¡€ 313 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €:¡€ 314 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €;¡€ 315 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €<¡€ 316 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€40€ €=¡€ 317 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €>¡€ 318 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €?¡€ 319 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €@¡€ 320 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €A¡€ 321 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €B¡€ 322 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €C¡€ 323 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€%0€ €D¡€ 324 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €E¡€ 325 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €F¡€ 326 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €G¡€ 327 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €H¡€ 328 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€%0€ €I¡€ 329 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €J¡€ 330 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €K¡€ 331 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €L¡€ 332 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €M¡€ 333 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €N¡€ 334 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €O¡€ 335 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €P¡€ 336 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €Q¡€ 337 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €R¡€ 338 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €S¡€ 339 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€%0€ €T¡€ 340 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €U¡€ 341 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €V¡€ 342 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €W¡€ 343 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €X¡€ 344 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€40€ €Y¡€ 345 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €Z¡€ 346 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €[¡€ 347 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €\¡€ 348 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €]¡€ 349 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €^¡€ 350 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €_¡€ 351 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €`¡€ 352 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €a¡€ 353 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €b¡€ 354 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €c¡€ 355 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €d¡€ 356 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €e¡€ 357 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€40€ €f¡€ 358 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €g¡€ 359 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €h¡€ 360 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €i¡€ 361 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €j¡€ 362 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €k¡€ 363 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €l¡€ 364 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €m¡€ 365 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €n¡€ 366 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €o¡€ 367 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €p¡€ 368 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €q¡€ 369 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €r¡€ 370 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €s¡€ 371 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €t¡€ 372 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €u¡€ 373 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €v¡€ 374 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €w¡€ 375 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €x¡€ 376 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €y¡€ 377 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €z¡€ 378 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €{¡€ 379 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €|¡€ 380 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €}¡€ 381 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €~¡€ 382 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€40€ €¡€ 383 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €€¡€ 384 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €¡€ 385 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €‚¡€ 386 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €ƒ¡€ 387 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €„¡€ 388 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€40€ €…¡€ 389 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €†¡€ 390 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €‡¡€ 391 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €ˆ¡€ 392 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €‰¡€ 393 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €Š¡€ 394 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€%0€ €‹¡€ 395 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €Œ¡€ 396 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 397 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €Ž¡€ 398 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 399 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 400 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €‘¡€ 401 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €’¡€ 402 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €“¡€ 403 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €”¡€ 404 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €•¡€ 405 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €–¡€ 406 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €—¡€ 407 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €˜¡€ 408 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €™¡€ 409 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€40€ €š¡€ 410 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €›¡€ 411 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €œ¡€ 412 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 413 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €ž¡€ 414 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €Ÿ¡€ 415 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ € ¡€ 416 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡¡€ 417 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €¢¡€ 418 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €£¡€ 419 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €¤¡€ 420 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¥¡€ 421 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¦¡€ 422 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €§¡€ 423 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¨¡€ 424 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €©¡€ 425 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €ª¡€ 426 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €«¡€ 427 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¬¡€ 428 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €­¡€ 429 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €®¡€ 430 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¯¡€ 431 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €°¡€ 432 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €±¡€ 433 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €²¡€ 434 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€40€ €³¡€ 435 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €´¡€ 436 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €µ¡€ 437 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €¶¡€ 438 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €·¡€ 439 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €¸¡€ 440 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¹¡€ 441 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €º¡€ 442 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €»¡€ 443 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¼¡€ 444 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €½¡€ 445 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €¾¡€ 446 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¿¡€ 447 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €À¡€ 448 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €Á¡€ 449 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €¡€ 450 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €á€ 451 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €Ä¡€ 452 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €Å¡€ 453 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €Æ¡€ 454 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €Ç¡€ 455 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €È¡€ 456 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €É¡€ 457 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €Ê¡€ 458 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €Ë¡€ 459 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €Ì¡€ 460 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €Í¡€ 461 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €Ρ€ 462 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €Ï¡€ 463 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €С€ 464 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €Ñ¡€ 465 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €Ò¡€ 466 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €Ó¡€ 467 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €Ô¡€ 468 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €Õ¡€ 469 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €Ö¡€ 470 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €ס€ 471 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €Ø¡€ 472 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €Ù¡€ 473 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €Ú¡€ 474 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €Û¡€ 475 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €Ü¡€ 476 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €Ý¡€ 477 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €Þ¡€ 478 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €ß¡€ 479 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €à¡€ 480 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €á¡€ 481 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €â¡€ 482 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €ã¡€ 483 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €ä¡€ 484 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €å¡€ 485 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €æ¡€ 486 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €ç¡€ 487 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €è¡€ 488 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €é¡€ 489 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €ê¡€ 490 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €ë¡€ 491 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €ì¡€ 492 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €í¡€ 493 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €î¡€ 494 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €ï¡€ 495 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €ð¡€ 496 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ ¤€0€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€ ¢€0€ €0€ €¡€ ¢€¡€0€ €¡€ ¢€ 0€ €0€ €¡€ ¢€¡€0€ €¡€ ¢€ 0€ €0€ €¡€ ¢€¡€0€ €¡€ ¢€0€ €0€ €¡€ ¢€¡€0€ €¡€ ¢€ 0€ €0€ €¡€ ¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€ ¢€ 0€ €0€ €¡€ ¢€¡€0€ €¡€!¢€0€ €0€ €¡€!¢€¡€0€ €¡€"¢€0€ €0€ €¡€"¢€¡€0€ €¡€#¢€ 0€ €0€ €¡€#¢€¡€0€ €¡€$¢€0€ €0€ €¡€$¢€¡€0€ €¡€%¢€0€ €0€ €¡€%¢€¡€0€ €¡€&¢€0€ €0€ €¡€&¢€¡€0€ €¡€'¢€0€ €0€ €¡€'¢€¡€0€ €¡€(¢€ 0€ €0€ €¡€(¢€¡€0€ €¡€)¢€0€ €0€ €¡€)¢€¡€0€ €¡€*¢€ 0€ €0€ €¡€*¢€¡€0€ €¡€+¢€0€ €0€ €¡€+¢€¡€0€ €¡€,¢€0€ €0€ €¡€,¢€¡€0€ €¡€-¢€0€ €0€ €¡€-¢€¡€0€ €¡€.¢€0€ €0€ €¡€.¢€¡€0€ €¡€/¢€ 0€ €0€ €¡€/¢€¡€0€ €¡€0¢€0€ €0€ €¡€0¢€¡€0€ €¡€1¢€ 0€ €0€ €¡€1¢€¡€0€ €¡€2¢€0€ €0€ €¡€2¢€¡€0€ €¡€3¢€ 0€ €0€ €¡€3¢€¡€0€ €¡€4¢€0€ €0€ €¡€4¢€¡€0€ €¡€5¢€0€ €0€ €¡€5¢€¡€0€ €¡€6¢€0€ €0€ €¡€6¢€¡€0€ €¡€7¢€0€ €0€ €¡€7¢€¡€0€ €¡€8¢€ 0€ €0€ €¡€8¢€¡€0€ €¡€9¢€0€ €0€ €¡€9¢€¡€0€ €¡€:¢€0€ €0€ €¡€:¢€¡€0€ €¡€;¢€0€ €0€ €¡€;¢€¡€0€ €¡€<¢€ 0€ €0€ €¡€<¢€¡€0€ €¡€=¢€ 0€ €0€ €¡€=¢€¡€0€ €¡€>¢€0€ €0€ €¡€>¢€¡€0€ €¡€?¢€0€ €0€ €¡€?¢€¡€0€ €¡€@¢€0€ €0€ €¡€@¢€¡€0€ €¡€A¢€ 0€ €0€ €¡€A¢€¡€0€ €¡€B¢€0€ €0€ €¡€B¢€¡€0€ €¡€C¢€0€ €0€ €¡€C¢€¡€0€ €¡€D¢€ 0€ €0€ €¡€D¢€¡€0€ €¡€E¢€ 0€ €0€ €¡€E¢€¡€0€ €¡€F¢€0€ €0€ €¡€F¢€¡€0€ €¡€G¢€ 0€ €0€ €¡€G¢€¡€0€ €¡€H¢€ 0€ €0€ €¡€H¢€¡€0€ €¡€I¢€0€ €0€ €¡€I¢€¡€0€ €¡€J¢€0€ €0€ €¡€J¢€¡€0€ €¡€K¢€0€ €0€ €¡€K¢€¡€0€ €¡€L¢€ 0€ €0€ €¡€L¢€¡€0€ €¡€M¢€ 0€ €0€ €¡€M¢€¡€0€ €¡€N¢€ 0€ €0€ €¡€N¢€¡€0€ €¡€O¢€0€ €0€ €¡€O¢€¡€0€ €¡€P¢€ 0€ €0€ €¡€P¢€¡€0€ €¡€Q¢€0€ €0€ €¡€Q¢€¡€0€ €¡€R¢€0€ €0€ €¡€R¢€¡€0€ €¡€S¢€ 0€ €0€ €¡€S¢€¡€0€ €¡€T¢€ 0€ €0€ €¡€T¢€¡€0€ €¡€U¢€ 0€ €0€ €¡€U¢€¡€0€ €¡€V¢€0€ €0€ €¡€V¢€¡€0€ €¡€W¢€0€ €0€ €¡€W¢€¡€0€ €¡€X¢€0€ €0€ €¡€X¢€¡€0€ €¡€Y¢€ 0€ €0€ €¡€Y¢€¡€0€ €¡€Z¢€0€ €0€ €¡€Z¢€¡€0€ €¡€[¢€ 0€ €0€ €¡€[¢€¡€0€ €¡€\¢€ 0€ €0€ €¡€\¢€¡€0€ €¡€]¢€ 0€ €0€ €¡€]¢€¡€0€ €¡€^¢€0€ €0€ €¡€^¢€¡€0€ €¡€_¢€ 0€ €0€ €¡€_¢€¡€0€ €¡€`¢€ 0€ €0€ €¡€`¢€¡€0€ €¡€a¢€0€ €0€ €¡€a¢€¡€0€ €¡€b¢€ 0€ €0€ €¡€b¢€¡€0€ €¡€c¢€ 0€ €0€ €¡€c¢€¡€0€ €¡€d¢€0€ €0€ €¡€d¢€¡€0€ €¡€e¢€ 0€ €0€ €¡€e¢€¡€0€ €¡€f¢€0€ €0€ €¡€f¢€¡€0€ €¡€g¢€0€ €0€ €¡€g¢€¡€0€ €¡€h¢€0€ €0€ €¡€h¢€¡€0€ €¡€i¢€0€ €0€ €¡€i¢€¡€0€ €¡€j¢€0€ €0€ €¡€j¢€¡€0€ €¡€k¢€ 0€ €0€ €¡€k¢€¡€0€ €¡€l¢€0€ €0€ €¡€l¢€¡€0€ €¡€m¢€0€ €0€ €¡€m¢€¡€0€ €¡€n¢€0€ €0€ €¡€n¢€¡€0€ €¡€o¢€ 0€ €0€ €¡€o¢€¡€0€ €¡€p¢€0€ €0€ €¡€p¢€¡€0€ €¡€q¢€0€ €0€ €¡€q¢€¡€0€ €¡€r¢€ 0€ €0€ €¡€r¢€¡€0€ €¡€s¢€0€ €0€ €¡€s¢€¡€0€ €¡€t¢€0€ €0€ €¡€t¢€¡€0€ €¡€u¢€0€ €0€ €¡€u¢€¡€0€ €¡€v¢€0€ €0€ €¡€v¢€¡€0€ €¡€w¢€0€ €0€ €¡€w¢€¡€0€ €¡€x¢€0€ €0€ €¡€x¢€¡€0€ €¡€y¢€0€ €0€ €¡€y¢€¡€0€ €¡€z¢€0€ €0€ €¡€z¢€¡€0€ €¡€{¢€0€ €0€ €¡€{¢€¡€0€ €¡€|¢€ 0€ €0€ €¡€|¢€¡€0€ €¡€}¢€ 0€ €0€ €¡€}¢€¡€0€ €¡€~¢€0€ €0€ €¡€~¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€€¢€0€ €0€ €¡€€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€‚¢€0€ €0€ €¡€‚¢€¡€0€ €¡€ƒ¢€0€ €0€ €¡€ƒ¢€¡€0€ €¡€„¢€0€ €0€ €¡€„¢€¡€0€ €¡€…¢€0€ €0€ €¡€…¢€¡€0€ €¡€†¢€0€ €0€ €¡€†¢€¡€0€ €¡€‡¢€ 0€ €0€ €¡€‡¢€¡€0€ €¡€ˆ¢€0€ €0€ €¡€ˆ¢€¡€0€ €¡€‰¢€0€ €0€ €¡€‰¢€¡€0€ €¡€Š¢€ 0€ €0€ €¡€Š¢€¡€0€ €¡€‹¢€0€ €0€ €¡€‹¢€¡€0€ €¡€Œ¢€ 0€ €0€ €¡€Œ¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€Ž¢€ 0€ €0€ €¡€Ž¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€‘¢€0€ €0€ €¡€‘¢€¡€0€ €¡€’¢€0€ €0€ €¡€’¢€¡€0€ €¡€“¢€ 0€ €0€ €¡€“¢€¡€0€ €¡€”¢€ 0€ €0€ €¡€”¢€¡€0€ €¡€•¢€ 0€ €0€ €¡€•¢€¡€0€ €¡€–¢€0€ €0€ €¡€–¢€¡€0€ €¡€—¢€0€ €0€ €¡€—¢€¡€0€ €¡€˜¢€0€ €0€ €¡€˜¢€¡€0€ €¡€™¢€ 0€ €0€ €¡€™¢€¡€0€ €¡€š¢€0€ €0€ €¡€š¢€¡€0€ €¡€›¢€ 0€ €0€ €¡€›¢€¡€0€ €¡€œ¢€0€ €0€ €¡€œ¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€ž¢€ 0€ €0€ €¡€ž¢€¡€0€ €¡€Ÿ¢€ 0€ €0€ €¡€Ÿ¢€¡€0€ €¡€ ¢€0€ €0€ €¡€ ¢€¡€0€ €¡€¡¢€ 0€ €0€ €¡€¡¢€¡€0€ €¡€¢¢€ 0€ €0€ €¡€¢¢€¡€0€ €¡€£¢€ 0€ €0€ €¡€£¢€¡€0€ €¡€¤¢€0€ €0€ €¡€¤¢€¡€0€ €¡€¥¢€ 0€ €0€ €¡€¥¢€¡€0€ €¡€¦¢€ 0€ €0€ €¡€¦¢€¡€0€ €¡€§¢€ 0€ €0€ €¡€§¢€¡€0€ €¡€¨¢€ 0€ €0€ €¡€¨¢€¡€0€ €¡€©¢€0€ €0€ €¡€©¢€¡€0€ €¡€ª¢€ 0€ €0€ €¡€ª¢€¡€0€ €¡€«¢€ 0€ €0€ €¡€«¢€¡€0€ €¡€¬¢€ 0€ €0€ €¡€¬¢€¡€0€ €¡€­¢€ 0€ €0€ €¡€­¢€¡€0€ €¡€®¢€0€ €0€ €¡€®¢€¡€0€ €¡€¯¢€ 0€ €0€ €¡€¯¢€¡€0€ €¡€°¢€ 0€ €0€ €¡€°¢€¡€0€ €¡€±¢€0€ €0€ €¡€±¢€¡€0€ €¡€²¢€ 0€ €0€ €¡€²¢€¡€0€ €¡€³¢€ 0€ €0€ €¡€³¢€¡€0€ €¡€´¢€0€ €0€ €¡€´¢€¡€0€ €¡€µ¢€ 0€ €0€ €¡€µ¢€¡€0€ €¡€¶¢€0€ €0€ €¡€¶¢€¡€0€ €¡€·¢€0€ €0€ €¡€·¢€¡€0€ €¡€¸¢€0€ €0€ €¡€¸¢€¡€0€ €¡€¹¢€ 0€ €0€ €¡€¹¢€¡€0€ €¡€º¢€ 0€ €0€ €¡€º¢€¡€0€ €¡€»¢€ 0€ €0€ €¡€»¢€¡€0€ €¡€¼¢€ 0€ €0€ €¡€¼¢€¡€0€ €¡€½¢€ 0€ €0€ €¡€½¢€¡€0€ €¡€¾¢€0€ €0€ €¡€¾¢€¡€0€ €¡€¿¢€ 0€ €0€ €¡€¿¢€¡€0€ €¡€À¢€0€ €0€ €¡€À¢€¡€0€ €¡€Á¢€0€ €0€ €¡€Á¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€â€ 0€ €0€ €¡€â€¡€0€ €¡€Ä¢€ 0€ €0€ €¡€Ä¢€¡€0€ €¡€Å¢€ 0€ €0€ €¡€Å¢€¡€0€ €¡€Æ¢€0€ €0€ €¡€Æ¢€¡€0€ €¡€Ç¢€0€ €0€ €¡€Ç¢€¡€0€ €¡€È¢€ 0€ €0€ €¡€È¢€¡€0€ €¡€É¢€ 0€ €0€ €¡€É¢€¡€0€ €¡€Ê¢€0€ €0€ €¡€Ê¢€¡€0€ €¡€Ë¢€0€ €0€ €¡€Ë¢€¡€0€ €¡€Ì¢€0€ €0€ €¡€Ì¢€¡€0€ €¡€Í¢€0€ €0€ €¡€Í¢€¡€0€ €¡€΢€ 0€ €0€ €¡€΢€¡€0€ €¡€Ï¢€ 0€ €0€ €¡€Ï¢€¡€0€ €¡€Т€ 0€ €0€ €¡€Т€¡€0€ €¡€Ñ¢€0€ €0€ €¡€Ñ¢€¡€0€ €¡€Ò¢€ 0€ €0€ €¡€Ò¢€¡€0€ €¡€Ó¢€ 0€ €0€ €¡€Ó¢€¡€0€ €¡€Ô¢€ 0€ €0€ €¡€Ô¢€¡€0€ €¡€Õ¢€ 0€ €0€ €¡€Õ¢€¡€0€ €¡€Ö¢€ 0€ €0€ €¡€Ö¢€¡€0€ €¡€×¢€ 0€ €0€ €¡€×¢€¡€0€ €¡€Ø¢€0€ €0€ €¡€Ø¢€¡€0€ €¡€Ù¢€ 0€ €0€ €¡€Ù¢€¡€0€ €¡€Ú¢€0€ €0€ €¡€Ú¢€¡€0€ €¡€Û¢€0€ €0€ €¡€Û¢€¡€0€ €¡€Ü¢€0€ €0€ €¡€Ü¢€¡€0€ €¡€Ý¢€0€ €0€ €¡€Ý¢€¡€0€ €¡€Þ¢€0€ €0€ €¡€Þ¢€¡€0€ €¡€ߢ€0€ €0€ €¡€ߢ€¡€0€ €¡€ࢀ0€ €0€ €¡€ࢀ¡€0€ €¡€ᢀ0€ €0€ €¡€ᢀ¡€0€ €¡€⢀0€ €0€ €¡€⢀¡€0€ €¡€㢀 0€ €0€ €¡€㢀¡€0€ €¡€䢀0€ €0€ €¡€䢀¡€0€ €¡€墀0€ €0€ €¡€墀¡€0€ €¡€梀 0€ €0€ €¡€梀¡€0€ €¡€碀0€ €0€ €¡€碀¡€0€ €¡€袀0€ €0€ €¡€袀¡€0€ €¡€颀 0€ €0€ €¡€颀¡€0€ €¡€ꢀ 0€ €0€ €¡€ꢀ¡€0€ €¡€뢀 0€ €0€ €¡€뢀¡€0€ €¡€좀 0€ €0€ €¡€좀¡€0€ €¡€í¢€ 0€ €0€ €¡€í¢€¡€0€ €¡€0€ €0€ €¡€¡€0€ €¡€0€ €0€ €¡€¡€0€ €¡€ð¢€ 0€ €0€ €¡€ð¢€¡€0€ €¡€ñ¢€0€ €0€ €¡€ñ¢€¡€0€ €¡€ò¢€ 0€ €0€ €¡€ò¢€¡€0€ €¡€ó¢€ 0€ €0€ €¡€ó¢€¡€0€ €¡€ô¢€0€ €0€ €¡€ô¢€¡€0€ €¡€õ¢€0€ €0€ €¡€õ¢€¡€0€ €¡€ö¢€ 0€ €0€ €¡€ö¢€¡€0€ €¡€÷¢€0€ €0€ €¡€÷¢€¡€0€ €¡€ø¢€0€ €0€ €¡€ø¢€¡€0€ €¡€ù¢€0€ €0€ €¡€ù¢€¡€0€ €¡€ú¢€0€ €0€ €¡€ú¢€¡€0€ €¡€û¢€0€ €0€ €¡€û¢€¡€0€ €¡€ü¢€ 0€ €0€ €¡€ü¢€¡€0€ €¡€ý¢€ 0€ €0€ €¡€ý¢€¡€0€ €¡€þ¢€ 0€ €0€ €¡€þ¢€¡€0€ €¡€ÿ¢€ 0€ €0€ €¡€ÿ¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€ ¢€ 0€ €0€ €¡€ ¢€¡€0€ €¡€ ¢€ 0€ €0€ €¡€ ¢€¡€0€ €¡€ ¢€ 0€ €0€ €¡€ ¢€¡€0€ €¡€ ¢€ 0€ €0€ €¡€ ¢€¡€0€ €¡€ ¢€0€ €0€ €¡€ ¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€ ¢€0€ €0€ €¡€ ¢€¡€0€ €¡€!¢€0€ €0€ €¡€!¢€¡€0€ €¡€"¢€ 0€ €0€ €¡€"¢€¡€0€ €¡€#¢€ 0€ €0€ €¡€#¢€¡€0€ €¡€$¢€0€ €0€ €¡€$¢€¡€0€ €¡€%¢€ 0€ €0€ €¡€%¢€¡€0€ €¡€&¢€ 0€ €0€ €¡€&¢€¡€0€ €¡€'¢€0€ €0€ €¡€'¢€¡€0€ €¡€(¢€ 0€ €0€ €¡€(¢€¡€0€ €¡€)¢€ 0€ €0€ €¡€)¢€¡€0€ €¡€*¢€0€ €0€ €¡€*¢€¡€0€ €¡€+¢€ 0€ €0€ €¡€+¢€¡€0€ €¡€,¢€ 0€ €0€ €¡€,¢€¡€0€ €¡€-¢€0€ €0€ €¡€-¢€¡€0€ €¡€.¢€0€ €0€ €¡€.¢€¡€0€ €¡€/¢€ 0€ €0€ €¡€/¢€¡€0€ €¡€0¢€0€ €0€ €¡€0¢€¡€0€ €¡€1¢€ 0€ €0€ €¡€1¢€¡€0€ €¡€2¢€0€ €0€ €¡€2¢€¡€0€ €¡€3¢€0€ €0€ €¡€3¢€¡€0€ €¡€4¢€0€ €0€ €¡€4¢€¡€0€ €¡€5¢€0€ €0€ €¡€5¢€¡€0€ €¡€6¢€0€ €0€ €¡€6¢€¡€0€ €¡€7¢€0€ €0€ €¡€7¢€¡€0€ €¡€8¢€ 0€ €0€ €¡€8¢€¡€0€ €¡€9¢€ 0€ €0€ €¡€9¢€¡€0€ €¡€:¢€ 0€ €0€ €¡€:¢€¡€0€ €¡€;¢€0€ €0€ €¡€;¢€¡€0€ €¡€<¢€0€ €0€ €¡€<¢€¡€0€ €¡€=¢€ 0€ €0€ €¡€=¢€¡€0€ €¡€>¢€0€ €0€ €¡€>¢€¡€0€ €¡€?¢€ 0€ €0€ €¡€?¢€¡€0€ €¡€@¢€ 0€ €0€ €¡€@¢€¡€0€ €¡€A¢€0€ €0€ €¡€A¢€¡€0€ €¡€B¢€ 0€ €0€ €¡€B¢€¡€0€ €¡€C¢€0€ €0€ €¡€C¢€¡€0€ €¡€D¢€0€ €0€ €¡€D¢€¡€0€ €¡€E¢€ 0€ €0€ €¡€E¢€¡€0€ €¡€F¢€0€ €0€ €¡€F¢€¡€0€ €¡€G¢€0€ €0€ €¡€G¢€¡€0€ €¡€H¢€0€ €0€ €¡€H¢€¡€0€ €¡€I¢€ 0€ €0€ €¡€I¢€¡€0€ €¡€J¢€0€ €0€ €¡€J¢€¡€0€ €¡€K¢€ 0€ €0€ €¡€K¢€¡€0€ €¡€L¢€0€ €0€ €¡€L¢€¡€0€ €¡€M¢€0€ €0€ €¡€M¢€¡€0€ €¡€N¢€0€ €0€ €¡€N¢€¡€0€ €¡€O¢€0€ €0€ €¡€O¢€¡€0€ €¡€P¢€ 0€ €0€ €¡€P¢€¡€0€ €¡€Q¢€ 0€ €0€ €¡€Q¢€¡€0€ €¡€R¢€ 0€ €0€ €¡€R¢€¡€0€ €¡€S¢€0€ €0€ €¡€S¢€¡€0€ €¡€T¢€0€ €0€ €¡€T¢€¡€0€ €¡€U¢€0€ €0€ €¡€U¢€¡€0€ €¡€V¢€0€ €0€ €¡€V¢€¡€0€ €¡€W¢€ 0€ €0€ €¡€W¢€¡€0€ €¡€X¢€0€ €0€ €¡€X¢€¡€0€ €¡€Y¢€0€ €0€ €¡€Y¢€¡€0€ €¡€Z¢€ 0€ €0€ €¡€Z¢€¡€0€ €¡€[¢€0€ €0€ €¡€[¢€¡€0€ €¡€\¢€0€ €0€ €¡€\¢€¡€0€ €¡€]¢€0€ €0€ €¡€]¢€¡€0€ €¡€^¢€0€ €0€ €¡€^¢€¡€0€ €¡€_¢€0€ €0€ €¡€_¢€¡€0€ €¡€`¢€0€ €0€ €¡€`¢€¡€0€ €¡€a¢€ 0€ €0€ €¡€a¢€¡€0€ €¡€b¢€ 0€ €0€ €¡€b¢€¡€0€ €¡€c¢€0€ €0€ €¡€c¢€¡€0€ €¡€d¢€ 0€ €0€ €¡€d¢€¡€0€ €¡€e¢€0€ €0€ €¡€e¢€¡€0€ €¡€f¢€ 0€ €0€ €¡€f¢€¡€0€ €¡€g¢€0€ €0€ €¡€g¢€¡€0€ €¡€h¢€0€ €0€ €¡€h¢€¡€0€ €¡€i¢€0€ €0€ €¡€i¢€¡€0€ €¡€j¢€0€ €0€ €¡€j¢€¡€0€ €¡€k¢€0€ €0€ €¡€k¢€¡€0€ €¡€l¢€0€ €0€ €¡€l¢€¡€0€ €¡€m¢€0€ €0€ €¡€m¢€¡€0€ €¡€n¢€ 0€ €0€ €¡€n¢€¡€0€ €¡€o¢€ 0€ €0€ €¡€o¢€¡€0€ €¡€p¢€ 0€ €0€ €¡€p¢€¡€0€ €¡€q¢€ 0€ €0€ €¡€q¢€¡€0€ €¡€r¢€ 0€ €0€ €¡€r¢€¡€0€ €¡€s¢€ 0€ €0€ €¡€s¢€¡€0€ €¡€t¢€ 0€ €0€ €¡€t¢€¡€0€ €¡€u¢€0€ €0€ €¡€u¢€¡€0€ €¡€v¢€0€ €0€ €¡€v¢€¡€0€ €¡€w¢€ 0€ €0€ €¡€w¢€¡€0€ €¡€x¢€ 0€ €0€ €¡€x¢€¡€0€ €¡€y¢€ 0€ €0€ €¡€y¢€¡€0€ €¡€z¢€0€ €0€ €¡€z¢€¡€0€ €¡€{¢€0€ €0€ €¡€{¢€¡€0€ €¡€|¢€0€ €0€ €¡€|¢€¡€0€ €¡€}¢€ 0€ €0€ €¡€}¢€¡€0€ €¡€~¢€0€ €0€ €¡€~¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€€¢€0€ €0€ €¡€€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€‚¢€ 0€ €0€ €¡€‚¢€¡€0€ €¡€ƒ¢€ 0€ €0€ €¡€ƒ¢€¡€0€ €¡€„¢€0€ €0€ €¡€„¢€¡€0€ €¡€…¢€ 0€ €0€ €¡€…¢€¡€0€ €¡€†¢€0€ €0€ €¡€†¢€¡€0€ €¡€‡¢€ 0€ €0€ €¡€‡¢€¡€0€ €¡€ˆ¢€ 0€ €0€ €¡€ˆ¢€¡€0€ €¡€‰¢€0€ €0€ €¡€‰¢€¡€0€ €¡€Š¢€0€ €0€ €¡€Š¢€¡€0€ €¡€‹¢€ 0€ €0€ €¡€‹¢€¡€0€ €¡€Œ¢€ 0€ €0€ €¡€Œ¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€Ž¢€ 0€ €0€ €¡€Ž¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€‘¢€ 0€ €0€ €¡€‘¢€¡€0€ €¡€’¢€ 0€ €0€ €¡€’¢€¡€0€ €¡€“¢€0€ €0€ €¡€“¢€¡€0€ €¡€”¢€0€ €0€ €¡€”¢€¡€0€ €¡€•¢€0€ €0€ €¡€•¢€¡€0€ €¡€–¢€0€ €0€ €¡€–¢€¡€0€ €¡€—¢€ 0€ €0€ €¡€—¢€¡€0€ €¡€˜¢€0€ €0€ €¡€˜¢€¡€0€ €¡€™¢€0€ €0€ €¡€™¢€¡€0€ €¡€š¢€0€ €0€ €¡€š¢€¡€0€ €¡€›¢€ 0€ €0€ €¡€›¢€¡€0€ €¡€œ¢€0€ €0€ €¡€œ¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€ž¢€0€ €0€ €¡€ž¢€¡€0€ €¡€Ÿ¢€0€ €0€ €¡€Ÿ¢€¡€0€ €¡€ ¢€0€ €0€ €¡€ ¢€¡€0€ €¡€¡¢€ 0€ €0€ €¡€¡¢€¡€0€ €¡€¢¢€0€ €0€ €¡€¢¢€¡€0€ €¡€£¢€0€ €0€ €¡€£¢€¡€0€ €¡€¤¢€0€ €0€ €¡€¤¢€¡€0€ €¡€¥¢€ 0€ €0€ €¡€¥¢€¡€0€ €¡€¦¢€0€ €0€ €¡€¦¢€¡€0€ €¡€§¢€0€ €0€ €¡€§¢€¡€0€ €¡€¨¢€ 0€ €0€ €¡€¨¢€¡€0€ €¡€©¢€0€ €0€ €¡€©¢€¡€0€ €¡€ª¢€0€ €0€ €¡€ª¢€¡€0€ €¡€«¢€ 0€ €0€ €¡€«¢€¡€0€ €¡€¬¢€ 0€ €0€ €¡€¬¢€¡€0€ €¡€­¢€0€ €0€ €¡€­¢€¡€0€ €¡€®¢€0€ €0€ €¡€®¢€¡€0€ €¡€¯¢€0€ €0€ €¡€¯¢€¡€0€ €¡€°¢€ 0€ €0€ €¡€°¢€¡€0€ €¡€±¢€ 0€ €0€ €¡€±¢€¡€0€ €¡€²¢€0€ €0€ €¡€²¢€¡€0€ €¡€³¢€0€ €0€ €¡€³¢€¡€0€ €¡€´¢€0€ €0€ €¡€´¢€¡€0€ €¡€µ¢€0€ €0€ €¡€µ¢€¡€0€ €¡€¶¢€ 0€ €0€ €¡€¶¢€¡€0€ €¡€·¢€ 0€ €0€ €¡€·¢€¡€0€ €¡€¸¢€ 0€ €0€ €¡€¸¢€¡€0€ €¡€¹¢€0€ €0€ €¡€¹¢€¡€0€ €¡€º¢€ 0€ €0€ €¡€º¢€¡€0€ €¡€»¢€0€ €0€ €¡€»¢€¡€0€ €¡€¼¢€ 0€ €0€ €¡€¼¢€¡€0€ €¡€½¢€0€ €0€ €¡€½¢€¡€0€ €¡€¾¢€0€ €0€ €¡€¾¢€¡€0€ €¡€¿¢€0€ €0€ €¡€¿¢€¡€0€ €¡€À¢€ 0€ €0€ €¡€À¢€¡€0€ €¡€Á¢€0€ €0€ €¡€Á¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€â€ 0€ €0€ €¡€â€¡€0€ €¡€Ä¢€ 0€ €0€ €¡€Ä¢€¡€0€ €¡€Å¢€ 0€ €0€ €¡€Å¢€¡€0€ €¡€Æ¢€0€ €0€ €¡€Æ¢€¡€0€ €¡€Ç¢€0€ €0€ €¡€Ç¢€¡€0€ €¡€È¢€ 0€ €0€ €¡€È¢€¡€0€ €¡€É¢€ 0€ €0€ €¡€É¢€¡€0€ €¡€Ê¢€ 0€ €0€ €¡€Ê¢€¡€0€ €¡€Ë¢€0€ €0€ €¡€Ë¢€¡€0€ €¡€Ì¢€0€ €0€ €¡€Ì¢€¡€0€ €¡€Í¢€0€ €0€ €¡€Í¢€¡€0€ €¡€΢€0€ €0€ €¡€΢€¡€0€ €¡€Ï¢€ 0€ €0€ €¡€Ï¢€¡€0€ €¡€Т€0€ €0€ €¡€Т€¡€0€ €¡€Ñ¢€ 0€ €0€ €¡€Ñ¢€¡€0€ €¡€Ò¢€ 0€ €0€ €¡€Ò¢€¡€0€ €¡€Ó¢€ 0€ €0€ €¡€Ó¢€¡€0€ €¡€Ô¢€0€ €0€ €¡€Ô¢€¡€0€ €¡€Õ¢€ 0€ €0€ €¡€Õ¢€¡€0€ €¡€Ö¢€0€ €0€ €¡€Ö¢€¡€0€ €¡€×¢€ 0€ €0€ €¡€×¢€¡€0€ €¡€Ø¢€ 0€ €0€ €¡€Ø¢€¡€0€ €¡€Ù¢€0€ €0€ €¡€Ù¢€¡€0€ €¡€Ú¢€ 0€ €0€ €¡€Ú¢€¡€0€ €¡€Û¢€0€ €0€ €¡€Û¢€¡€0€ €¡€Ü¢€ 0€ €0€ €¡€Ü¢€¡€0€ €¡€Ý¢€0€ €0€ €¡€Ý¢€¡€0€ €¡€Þ¢€0€ €0€ €¡€Þ¢€¡€0€ €¡€ߢ€ 0€ €0€ €¡€ߢ€¡€0€ €¡€ࢀ0€ €0€ €¡€ࢀ¡€0€ €¡€ᢀ0€ €0€ €¡€ᢀ¡€0€ €¡€⢀0€ €0€ €¡€⢀¡€0€ €¡€㢀0€ €0€ €¡€㢀¡€0€ €¡€䢀 0€ €0€ €¡€䢀¡€0€ €¡€墀 0€ €0€ €¡€墀¡€0€ €¡€梀0€ €0€ €¡€梀¡€0€ €¡€碀0€ €0€ €¡€碀¡€0€ €¡€袀 0€ €0€ €¡€袀¡€0€ €¡€颀0€ €0€ €¡€颀¡€0€ €¡€ꢀ 0€ €0€ €¡€ꢀ¡€0€ €¡€뢀 0€ €0€ €¡€뢀¡€0€ €¡€좀0€ €0€ €¡€좀¡€0€ €¡€í¢€ 0€ €0€ €¡€í¢€¡€0€ €¡€0€ €0€ €¡€¡€0€ €¡€ 0€ €0€ €¡€¡€0€ €¡€ð¢€ 0€ €0€ €¡€¢€ ¡€0€ €¡€V¢€ 0€ €0€ €¡€F¢€ ¡€0€ €¡€s¢€ 0€ €0€ €¡€¢€ ¡€0€ €¡€ ¢€ 0€ €0€ €¡€z¢€ ¡€0€ €¡€€¢€ 0€ €0€ €¡€¢€ ¡€0€ €¡€΢€ 0€ €¡€0€ €1¨€£€0€0€ €¡€ 499 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 501 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 497 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 498 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 502 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 503 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 504 ¢€ €0€ € ¡€0€ €1¨€£€0€0€ €¡€ 505 ¢€ €0€ € ¡€0€ €1¨€£€0€0€ €¡€ 506 ¢€ €0€ € ¡€0€ €1¨€£€0€0€ €¡€ 507 ¢€ €0€ € ¡€0€ €1¨€£€0€0€ €¡€ 508 ¢€ €0€ € ¡€0€ €1¨€£€0€0€ €¡€ 509 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 510 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 511 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 512 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 513 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 514 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 515 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 516 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 517 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 518 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 519 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 520 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 521 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 522 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 523 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 524 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 525 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 526 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 527 ¢€ €0€ € ¡€0€ €1¨€£€0€0€ €¡€ 528 ¢€ €0€ €!¡€0€ €1¨€£€0€0€ €¡€ 529 ¢€ €0€ €"¡€0€ €1¨€£€0€0€ €¡€ 530 ¢€ €0€ €#¡€0€ €1¨€£€0€0€ €¡€ 531 ¢€ €0€ €$¡€0€ €1¨€£€0€0€ €¡€ 532 ¢€ €0€ €%¡€0€ €1¨€£€0€0€ €¡€ 533 ¢€ €0€ €&¡€0€ €1¨€£€0€0€ €¡€ 534 ¢€ €0€ €'¡€0€ €1¨€£€0€0€ €¡€ 535 ¢€ €0€ €(¡€0€ €1¨€£€0€0€ €¡€ 536 ¢€ €0€ €)¡€0€ €1¨€£€0€0€ €¡€ 537 ¢€ €0€ €*¡€0€ €1¨€£€0€0€ €¡€ 538 ¢€ €0€ €+¡€0€ €1¨€£€0€0€ €¡€ 539 ¢€ €0€ €,¡€0€ €1¨€£€0€0€ €¡€ 540 ¢€ €0€ €-¡€0€ €1¨€£€0€0€ €¡€ 541 ¢€ €0€ €.¡€0€ €1¨€£€0€0€ €¡€ 542 ¢€ €0€ €/¡€0€ €1¨€£€0€0€ €¡€ 543 ¢€ €0€ €0¡€0€ €1¨€£€0€0€ €¡€ 544 ¢€ €0€ €1¡€0€ €1¨€£€0€0€ €¡€ 545 ¢€ €0€ €2¡€0€ €1¨€£€0€0€ €¡€ 546 ¢€ €0€ €3¡€0€ €1¨€£€0€0€ €¡€ 547 ¢€ €0€ €4¡€0€ €1¨€£€0€0€ €¡€ 548 ¢€ €0€ €5¡€0€ €1¨€£€0€0€ €¡€ 549 ¢€ €0€ €6¡€0€ €1¨€£€0€0€ €¡€ 550 ¢€ €0€ €7¡€0€ €1¨€£€0€0€ €¡€ 551 ¢€ €0€ €8¡€0€ €1¨€£€0€0€ €¡€ 552 ¢€ €0€ €9¡€0€ €1¨€£€0€0€ €¡€ 553 ¢€ €0€ €:¡€0€ €1¨€£€0€0€ €¡€ 554 ¢€ €0€ €;¡€0€ €1¨€£€0€0€ €¡€ 555 ¢€ €0€ €<¡€0€ €1¨€£€0€0€ €¡€ 556 ¢€ €0€ €=¡€0€ €1¨€£€0€0€ €¡€ 557 ¢€ €0€ €>¡€0€ €1¨€£€0€0€ €¡€ 558 ¢€ €0€ €?¡€0€ €1¨€£€0€0€ €¡€ 559 ¢€ €0€ €@¡€0€ €1¨€£€0€0€ €¡€ 560 ¢€ €0€ €A¡€0€ €1¨€£€0€0€ €¡€ 561 ¢€ €0€ €B¡€0€ €1¨€£€0€0€ €¡€ 562 ¢€ €0€ €C¡€0€ €1¨€£€0€0€ €¡€ 563 ¢€ €0€ €D¡€0€ €1¨€£€0€0€ €¡€ 564 ¢€ €0€ €E¡€0€ €1¨€£€0€0€ €¡€ 565 ¢€ €0€ €F¡€0€ €1¨€£€0€0€ €¡€ 566 ¢€ €0€ €G¡€0€ €1¨€£€0€0€ €¡€ 567 ¢€ €0€ €H¡€0€ €1¨€£€0€0€ €¡€ 568 ¢€ €0€ €I¡€0€ €1¨€£€0€0€ €¡€ 569 ¢€ €0€ €J¡€0€ €1¨€£€0€0€ €¡€ 570 ¢€ €0€ €K¡€0€ €1¨€£€0€0€ €¡€ 571 ¢€ €0€ €L¡€0€ €1¨€£€0€0€ €¡€ 572 ¢€ €0€ €M¡€0€ €1¨€£€0€0€ €¡€ 573 ¢€ €0€ €N¡€0€ €1¨€£€0€0€ €¡€ 574 ¢€ €0€ €O¡€0€ €1¨€£€0€0€ €¡€ 575 ¢€ €0€ €P¡€0€ €1¨€£€0€0€ €¡€ 576 ¢€ €0€ €Q¡€0€ €1¨€£€0€0€ €¡€ 577 ¢€ €0€ €R¡€0€ €1¨€£€0€0€ €¡€ 578 ¢€ €0€ €S¡€0€ €1¨€£€0€0€ €¡€ 579 ¢€ €0€ €T¡€0€ €1¨€£€0€0€ €¡€ 580 ¢€ €0€ €U¡€0€ €1¨€£€0€0€ €¡€ 581 ¢€ €0€ €V¡€0€ €1¨€£€0€0€ €¡€ 582 ¢€ €0€ €W¡€0€ €1¨€£€0€0€ €¡€ 583 ¢€ €0€ €X¡€0€ €1¨€£€0€0€ €¡€ 584 ¢€ €0€ €Y¡€0€ €1¨€£€0€0€ €¡€ 585 ¢€ €0€ €Z¡€0€ €1¨€£€0€0€ €¡€ 586 ¢€ €0€ €[¡€0€ €1¨€£€0€0€ €¡€ 587 ¢€ €0€ €\¡€0€ €1¨€£€0€0€ €¡€ 588 ¢€ €0€ €]¡€0€ €1¨€£€0€0€ €¡€ 589 ¢€ €0€ €^¡€0€ €1¨€£€0€0€ €¡€ 590 ¢€ €0€ €_¡€0€ €1¨€£€0€0€ €¡€ 591 ¢€ €0€ €`¡€0€ €1¨€£€0€0€ €¡€ 592 ¢€ €0€ €a¡€0€ €1¨€£€0€0€ €¡€ 593 ¢€ €0€ €b¡€0€ €1¨€£€0€0€ €¡€ 594 ¢€ €0€ €c¡€0€ €1¨€£€0€0€ €¡€ 595 ¢€ €0€ €d¡€0€ €1¨€£€0€0€ €¡€ 596 ¢€ €0€ €e¡€0€ €1¨€£€0€0€ €¡€ 597 ¢€ €0€ €f¡€0€ €1¨€£€0€0€ €¡€ 598 ¢€ €0€ €g¡€0€ €1¨€£€0€0€ €¡€ 599 ¢€ €0€ €h¡€0€ €1¨€£€0€0€ €¡€ 600 ¢€ €0€ €i¡€0€ €1¨€£€0€0€ €¡€ 601 ¢€ €0€ €j¡€0€ €1¨€£€0€0€ €¡€ 602 ¢€ €0€ €k¡€0€ €1¨€£€0€0€ €¡€ 603 ¢€ €0€ €l¡€0€ €1¨€£€0€0€ €¡€ 604 ¢€ €0€ €m¡€0€ €1¨€£€0€0€ €¡€ 605 ¢€ €0€ €n¡€0€ €1¨€£€0€0€ €¡€ 606 ¢€ €0€ €o¡€0€ €1¨€£€0€0€ €¡€ 607 ¢€ €0€ €p¡€0€ €1¨€£€0€0€ €¡€ 608 ¢€ €0€ €q¡€0€ €1¨€£€0€0€ €¡€ 609 ¢€ €0€ €r¡€0€ €1¨€£€0€0€ €¡€ 610 ¢€ €0€ €s¡€0€ €1¨€£€0€0€ €¡€ 612 ¢€ €0€ €t¡€0€ €1¨€£€0€0€ €¡€ 613 ¢€ €0€ €u¡€0€ €1¨€£€0€0€ €¡€ 614 ¢€ €0€ €v¡€0€ €1¨€£€0€0€ €¡€ 615 ¢€ €0€ €w¡€0€ €1¨€£€0€0€ €¡€ 616 ¢€ €0€ €x¡€0€ €1¨€£€0€0€ €¡€ 617 ¢€ €0€ €y¡€0€ €1¨€£€0€0€ €¡€ 618 ¢€ €0€ €z¡€0€ €1¨€£€0€0€ €¡€ 619 ¢€ €0€ €{¡€0€ €1¨€£€0€0€ €¡€ 620 ¢€ €0€ €|¡€0€ €1¨€£€0€0€ €¡€ 622 ¢€ €0€ €}¡€0€ €1¨€£€0€0€ €¡€ 623 ¢€ €0€ €~¡€0€ €1¨€£€0€0€ €¡€ 624 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 625 ¢€ €0€ €€¡€0€ €1¨€£€0€0€ €¡€ 626 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 627 ¢€ €0€ €‚¡€0€ €1¨€£€0€0€ €¡€ 628 ¢€ €0€ €ƒ¡€0€ €1¨€£€0€0€ €¡€ 629 ¢€ €0€ €„¡€0€ €1¨€£€0€0€ €¡€ 630 ¢€ €0€ €…¡€0€ €1¨€£€0€0€ €¡€ 631 ¢€ €0€ €†¡€0€ €1¨€£€0€0€ €¡€ 632 ¢€ €0€ €‡¡€0€ €1¨€£€0€0€ €¡€ 633 ¢€ €0€ €ˆ¡€0€ €1¨€£€0€0€ €¡€ 634 ¢€ €0€ €‰¡€0€ €1¨€£€0€0€ €¡€ 635 ¢€ €¢€0€0€ €0€ €¡€Í¢€¡€0€ €¡€¢€0€ €0€ €¡€d¢€ ¡€0€ €¡€¢€0€ €0€ €¡€ž¢€¡€0€ €¡€¢€0€ €0€ €¡€§¢€¡€0€ €¡€¢€0€ €0€ €¡€§¢€ ¡€0€ €¡€¢€0€ €0€ €¡€§¢€ ¡€0€ €¡€¢€0€ €0€ €¡€É¢€¡€0€ €¡€¢€£€0€0€ €¡€0€ €PCA NH3+£€¢€£€0€X¤€0€0€ €¡€ N ¢€0€ N £€ 0€ €¡€ CA ¢€0€ CA £€ 0€ €¡€ CB ¢€0€ CB £€ 0€ €¡€ CG ¢€0€ CG £€ 0€ €¡€ CD ¢€0€ CD £€ 0€ €¡€ OE ¢€0€ OE £€ 0€ €¡€ C ¢€0€ C £€ 0€ €¡€ O ¢€0€ O £€ ¥€0€0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€0€ €NAG£€¢€ÿ£€0€X¤€0€0€ €¡€ C1 ¢€0€ C1 £€ 0€ €¡€ C2 ¢€0€ C2 £€ 0€ €¡€ C3 ¢€0€ C3 £€ 0€ €¡€ C4 ¢€0€ C4 £€ 0€ €¡€ C5 ¢€0€ C5 £€ 0€ €¡€ C6 ¢€0€ C6 £€ 0€ €¡€ C7 ¢€0€ C7 £€ 0€ €¡€ C8 ¢€0€ C8 £€ 0€ € ¡€ N2 ¢€0€ N2 £€ 0€ € ¡€ O3 ¢€0€ O3 £€ 0€ € ¡€ O4 ¢€0€ O4 £€ 0€ € ¡€ O5 ¢€0€ O5 £€ 0€ € ¡€ O6 ¢€0€ O6 £€ 0€ €¡€ O7 ¢€0€ O7 £€ ¥€0€0€ €¡€¢€ÿ0€ €¡€ ¢€ÿ0€ €¡€¢€ÿ0€ €¡€ ¢€ÿ0€ €¡€¢€ÿ0€ €¡€ ¢€ÿ0€ €¡€¢€ÿ0€ €¡€ ¢€ÿ0€ €¡€¢€ÿ0€ €¡€ ¢€ÿ0€ €¡€ ¢€ÿ0€ €¡€¢€ÿ0€ €¡€ ¢€ÿ0€ €¡€¢€ÿ0€ €¡€0€ €6SA£€¢€ÿ£€0€X¤€0€0€ €¡€ CR1¢€0€ CR1£€ 0€ €¡€ CR2¢€0€ CR2£€ 0€ €¡€ CR3¢€0€ CR3£€ 0€ €¡€ CR4¢€0€ CR4£€ 0€ €¡€ CR5¢€0€ CR5£€ 0€ €¡€ CR6¢€0€ CR6£€ 0€ €¡€ OR1¢€0€ OR1£€ 0€ €¡€ OR2¢€0€ OR2£€ 0€ € ¡€ OR3¢€0€ OR3£€ 0€ € ¡€ OR4¢€0€ OR4£€ 0€ € ¡€ OR5¢€0€ OR5£€ 0€ € ¡€ OR6¢€0€ OR6£€ 0€ € ¡€ CY1¢€0€ CY1£€ 0€ €¡€ CY2¢€0€ CY2£€ 0€ €¡€ CY3¢€0€ CY3£€ 0€ €¡€ CY4¢€0€ CY4£€ 0€ €¡€ CY5¢€0€ CY5£€ 0€ €¡€ CY6¢€0€ CY6£€ 0€ €¡€ OY2¢€0€ OY2£€ 0€ €¡€ OY3¢€0€ OY3£€ 0€ €¡€ NY4¢€0€ NY4£€ 0€ €¡€ OY5¢€0€ OY5£€ 0€ €¡€ CQ1¢€0€ CQ1£€ 0€ €¡€ CQ2¢€0€ CQ2£€ 0€ €¡€ OQ2¢€0€ OQ2£€ 0€ €¡€ CQ3¢€0€ CQ3£€ 0€ €¡€ OQ3¢€0€ OQ3£€ 0€ €¡€ CQ4¢€0€ CQ4£€ 0€ €¡€ OQ4¢€0€ OQ4£€ 0€ €¡€ CQ5¢€0€ CQ5£€ 0€ €¡€ CQ6¢€0€ CQ6£€ 0€ € ¡€ CQ7¢€0€ CQ7£€ 0€ €!¡€ OQ7¢€0€ OQ7£€ 0€ €"¡€ CW1¢€0€ CW1£€ 0€ €#¡€ CW2¢€0€ CW2£€ 0€ €$¡€ CW3¢€0€ CW3£€ 0€ €%¡€ CW4¢€0€ CW4£€ 0€ €&¡€ CW5¢€0€ CW5£€ 0€ €'¡€ CW6¢€0€ CW6£€ 0€ €(¡€ OW2¢€0€ OW2£€ 0€ €)¡€ OW3¢€0€ OW3£€ 0€ €*¡€ OW4¢€0€ OW4£€ 0€ €+¡€ OW5¢€0€ OW5£€ 0€ €,¡€ OW1¢€0€ OW1£€ 0€ €-¡€ CP1¢€0€ CP1£€ 0€ €.¡€ CP2¢€0€ CP2£€ 0€ €/¡€ CP3¢€0€ CP3£€ 0€ €0¡€ CP4¢€0€ CP4£€ 0€ €1¡€ CP5¢€0€ CP5£€ 0€ €2¡€ CP6¢€0€ CP6£€ 0€ €3¡€ OU2¢€0€ OU2£€ 0€ €4¡€ OP3¢€0€ OP3£€ 0€ €5¡€ OP4¢€0€ OP4£€ 0€ €6¡€ OP5¢€0€ OP5£€ 0€ €7¡€ OP6¢€0€ OP6£€ 0€ €8¡€ CV1¢€0€ CV1£€ 0€ €9¡€ CV2¢€0€ CV2£€ 0€ €:¡€ CV3¢€0€ CV3£€ 0€ €;¡€ CV4¢€0€ CV4£€ 0€ €<¡€ CV5¢€0€ CV5£€ 0€ €=¡€ CV6¢€0€ CV6£€ 0€ €>¡€ OV2¢€0€ OV2£€ 0€ €?¡€ OV3¢€0€ OV3£€ 0€ €@¡€ OV4¢€0€ OV4£€ 0€ €A¡€ OV5¢€0€ OV5£€ 0€ €B¡€ OV6¢€0€ OV6£€ ¥€0€0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€ ¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€ ¢€ÿ0€ €¡€¢€ÿ0€ €¡€ ¢€ÿ0€ €¡€¢€ÿ0€ €¡€ ¢€ÿ0€ €¡€ ¢€ÿ0€ €¡€'¢€ÿ0€ € ¡€ ¢€ÿ0€ € ¡€¢€ÿ0€ € ¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€-¢€ÿ0€ €¡€¢€ÿ0€ €¡€ ¢€ÿ0€ € ¡€!¢€ÿ0€ €"¡€#¢€ÿ0€ €"¡€+¢€ÿ0€ €"¡€,¢€ÿ0€ €#¡€$¢€ÿ0€ €#¡€(¢€ÿ0€ €$¡€%¢€ÿ0€ €$¡€)¢€ÿ0€ €%¡€&¢€ÿ0€ €%¡€*¢€ÿ0€ €&¡€'¢€ÿ0€ €&¡€+¢€ÿ0€ €-¡€.¢€ÿ0€ €-¡€6¢€ÿ0€ €.¡€/¢€ÿ0€ €.¡€3¢€ÿ0€ €/¡€0¢€ÿ0€ €/¡€4¢€ÿ0€ €0¡€1¢€ÿ0€ €0¡€5¢€ÿ0€ €1¡€2¢€ÿ0€ €1¡€6¢€ÿ0€ €2¡€7¢€ÿ0€ €5¡€8¢€ÿ0€ €8¡€9¢€ÿ0€ €8¡€A¢€ÿ0€ €9¡€:¢€ÿ0€ €9¡€>¢€ÿ0€ €:¡€;¢€ÿ0€ €:¡€?¢€ÿ0€ €;¡€<¢€ÿ0€ €;¡€@¢€ÿ0€ €<¡€=¢€ÿ0€ €<¡€A¢€ÿ0€ €=¡€B¢€ÿ0€ €¡€0€ € CA£€¢€ÿ£€0€X¤€0€0€ €¡€CA ¢€0€CA £€ ¥€0€0€ €¡€0€ € CL£€¢€ÿ£€0€X¤€0€0€ €¡€CL ¢€0€CL £€ ¥€0€0€ €¡€0€ €HOH£€¢€ÿ£€0€X¤€0€0€ €¡€ O ¢€0€ O £€ ¥€0€£€0€0€ €¡€0€ €PDB secondary structure¢€0€0€ €¡€ 1¢€¤€ €¡€¡€0€0€ €¡€¢€0€ €¡€ 2¢€¤€ €¡€¡€0€0€ €¡€9¢€?0€ €¡€ 3¢€¤€ €¡€¡€0€0€ €¡€K¢€X0€ €¡€ 4¢€¤€ €¡€¡€0€0€ €¡€„¢€ˆ0€ €¡€ 5¢€¤€ €¡€¡€0€0€ €¡€™¢€ 0€ €¡€ 6¢€¤€ €¡€¡€0€0€ €¡€¬¢€¾0€ €¡€ 7¢€¤€ €¡€¡€0€0€ €¡€Æ¢€Ê0€ €¡€ 8¢€¤€ €¡€¡€0€0€ €¡€Ë¢€Ô0€ € ¡€ 9¢€¤€ €¡€¡€0€0€ €¡€ó¢€ø0€ € ¡€ 10¢€¤€ €¡€¡€0€0€ €¡€¢€ 0€ € ¡€ 11¢€¤€ €¡€¡€0€0€ €¡€¢€0€ € ¡€ 12¢€¤€ €¡€¡€0€0€ €¡€¢€0€ € ¡€ 13¢€¤€ €¡€¡€0€0€ €¡€ ¢€"0€ €¡€ 14¢€¤€ €¡€¡€0€0€ €¡€,¢€00€ €¡€ 15¢€¤€ €¡€¡€0€0€ €¡€4¢€80€ €¡€ 16¢€¤€ €¡€¡€0€0€ €¡€:¢€<0€ €¡€ 17¢€¤€ €¡€¡€0€0€ €¡€=¢€K0€ €¡€ 18¢€¤€ €¡€¡€0€0€ €¡€€¢€ƒ0€ €¡€ 19¢€¤€ €¡€¡€0€0€ €¡€„¢€‘0€ €¡€ 20¢€¤€ €¡€¡€0€0€ €¡€í¢€ï0€ €¡€ A 1¢€¤€ €¡€¡€0€0€ €¡€ ¢€0€ €¡€ A 2¢€¤€ €¡€¡€0€0€ €¡€'¢€*0€ €¡€ A 3¢€¤€ €¡€¡€0€0€ €¡€\¢€a0€ €¡€ A 4¢€¤€ €¡€¡€0€0€ €¡€Á¢€Ä0€ €¡€ A 5¢€¤€ €¡€¡€0€0€ €¡€墀è0€ €¡€ A 6¢€¤€ €¡€¡€0€0€ €¡€ü¢€þ0€ €¡€ A 7¢€¤€ €¡€¡€0€0€ €¡€$¢€&0€ €¡€ A 8¢€¤€ €¡€¡€0€0€ €¡€O¢€T0€ €¡€ B 1¢€¤€ €¡€¡€0€0€ €¡€e¢€h0€ €¡€ B 2¢€¤€ €¡€¡€0€0€ €¡€¥¢€§0€ €¡€ C 1¢€¤€ €¡€¡€0€0€ €¡€\¢€]0€ € ¡€ C 2¢€¤€ €¡€¡€0€0€ €¡€`¢€a0€ €!¡€ D 1¢€¤€ €¡€¡€0€0€ €¡€j¢€k0€ €"¡€ D 2¢€¤€ €¡€¡€0€0€ €¡€n¢€o0€ €#¡€ E 1¢€¤€ €¡€¡€0€0€ €¡€–¢€›0€ €$¡€ E 2¢€¤€ €¡€¡€0€0€ €¡€ ¢€¥0€ €%¡€ E 3¢€¤€ €¡€¡€0€0€ €¡€©¢€®0€ €&¡€ E 4¢€¤€ €¡€¡€0€0€ €¡€碀ë0€ €'¡€ F 1¢€¤€ €¡€¡€0€0€ €¡€´¢€¹0€ €(¡€ F 2¢€¤€ €¡€¡€0€0€ €¡€Ú¢€ß0€ €)¡€ G 1¢€¤€ €¡€¡€0€0€ €¡€¿¢€Â0€ €*¡€ G 2¢€¤€ €¡€¡€0€0€ €¡€Ò¢€Õ0€ €+¡€ H 1¢€¤€ €¡€¡€0€0€ €¡€É¢€Ê0€ €,¡€ H 2¢€¤€ €¡€¡€0€0€ €¡€Í¢€Î0€ €¡€0€ €!NCBI assigned secondary structure¢€0€0€ €¡€helix 1¢€¤€ €¡€¡€0€0€ €¡€¢€0€ €¡€helix 2¢€¤€ €¡€¡€0€0€ €¡€M¢€Y0€ €¡€helix 3¢€¤€ €¡€¡€0€0€ €¡€™¢€ 0€ €¡€helix 4¢€¤€ €¡€¡€0€0€ €¡€­¢€½0€ €¡€helix 5¢€¤€ €¡€¡€0€0€ €¡€Ì¢€Õ0€ €¡€helix 6¢€¤€ €¡€¡€0€0€ €¡€¢€ 0€ €¡€helix 7¢€¤€ €¡€¡€0€0€ €¡€>¢€J0€ €¡€helix 8¢€¤€ €¡€¡€0€0€ €¡€…¢€‘0€ € ¡€strand 1¢€¤€ €¡€¡€0€0€ €¡€ ¢€0€ € ¡€strand 2¢€¤€ €¡€¡€0€0€ €¡€&¢€+0€ € ¡€strand 3¢€¤€ €¡€¡€0€0€ €¡€/¢€20€ € ¡€strand 4¢€¤€ €¡€¡€0€0€ €¡€E¢€H0€ € ¡€strand 5¢€¤€ €¡€¡€0€0€ €¡€I¢€L0€ €¡€strand 6¢€¤€ €¡€¡€0€0€ €¡€[¢€b0€ €¡€strand 7¢€¤€ €¡€¡€0€0€ €¡€d¢€g0€ €¡€strand 8¢€¤€ €¡€¡€0€0€ €¡€p¢€s0€ €¡€strand 9¢€¤€ €¡€¡€0€0€ €¡€w¢€z0€ €¡€ strand 10¢€¤€ €¡€¡€0€0€ €¡€{¢€0€ €¡€ strand 11¢€¤€ €¡€¡€0€0€ €¡€‚¢€…0€ €¡€ strand 12¢€¤€ €¡€¡€0€0€ €¡€¥¢€¨0€ €¡€ strand 13¢€¤€ €¡€¡€0€0€ €¡€À¢€Å0€ €¡€ strand 14¢€¤€ €¡€¡€0€0€ €¡€䢀é0€ €¡€ strand 15¢€¤€ €¡€¡€0€0€ €¡€û¢€ÿ0€ €¡€ strand 16¢€¤€ €¡€¡€0€0€ €¡€#¢€'0€ €¡€ strand 17¢€¤€ €¡€¡€0€0€ €¡€N¢€W0€ €¡€ strand 18¢€¤€ €¡€¡€0€0€ €¡€Z¢€]0€ €¡€ strand 19¢€¤€ €¡€¡€0€0€ €¡€`¢€c0€ €¡€ strand 20¢€¤€ €¡€¡€0€0€ €¡€s¢€v0€ €¡€ strand 21¢€¤€ €¡€¡€0€0€ €¡€x¢€{0€ €¡€ strand 22¢€¤€ €¡€¡€0€0€ €¡€}¢€€0€ €¡€ strand 23¢€¤€ €¡€¡€0€0€ €¡€•¢€œ0€ € ¡€ strand 24¢€¤€ €¡€¡€0€0€ €¡€Ÿ¢€¦0€ €!¡€ strand 25¢€¤€ €¡€¡€0€0€ €¡€¨¢€¯0€ €"¡€ strand 26¢€¤€ €¡€¡€0€0€ €¡€²¢€º0€ €#¡€ strand 27¢€¤€ €¡€¡€0€0€ €¡€¾¢€Ã0€ €$¡€ strand 28¢€¤€ €¡€¡€0€0€ €¡€Ç¢€Ë0€ €%¡€ strand 29¢€¤€ €¡€¡€0€0€ €¡€Ì¢€Ð0€ €&¡€ strand 30¢€¤€ €¡€¡€0€0€ €¡€Ñ¢€Ö0€ €'¡€ strand 31¢€¤€ €¡€¡€0€0€ €¡€Ù¢€á0€ €(¡€ strand 32¢€¤€ €¡€¡€0€0€ €¡€梀ì0€ €¡€0€ € NCBI Domains¢€0€0€ €¡€Domain¢€d¤€ €¡€¡€0€0€ €¡€¢€u0€ €¡€£¢€‚0€ €¡€Domain¢€d¤€ €¡€¡€0€0€ €¡€v¢€0€ €¡€Domain¢€d¤€ €¡€¡€0€0€ €¡€ƒ¢€ð¤€0€0€ €¡€¢€0€ €QSingle-coordinate-per-atom model from PDB entry 1XD1 with a vector model attached¡€Resolution: 2.2¢€X-Ray Diffraction£€DEC 7 4 Initial Entry£€0€ € ¡€ ¤€0€0€ €¢€ € €0€ €@¡€0€ €@¡€0€      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~€‚ƒ„…†‡ˆ‰¢€0€                                            !!!!!"""""""#########$$$$%%%%%%%%%%%&&&&''''((((((()))))))))*******++++++,,,,,,,-------......../////////000000001111111222223333333344444444444455555555666666677777777777888888888889999999::::::::::::::;;;;;;;;;;;;;;<<<<<<<<<===========>>>>>>>>>>>>?????????@@@@@@@AAAAAAABBBBBBCCCCCCCCCCCCDDDDDDDDDEEEEEEEEFFFFFFGGGGGGGHHHHHHHHHHHIIIIIIJJJJKKKKKKKKLLLLLLLLLMMMMMMMMNNNNNNNNNOOOOOOOOOOOPPPPPPPPPPPQQQQQQQQRRRRRRRRSSSSSSSTTTTTTTUUUUUUUUUUUVVVVVVWWWWWWWWXXXXXXXXYYYYYYYZZZZ[[[[[[[\\\\\\\\\\\]]]]]]]]^^^^^^^^^^^^_______````````aaaaabbbbbbbccccccccddddddddeeeeeeeeeeffffffffgggggghhhhiiiiiiiijjjjjkkkkkkkllllllmmmmmnnnnoooooooppppppqqqqqqrrrrrrrssssssttttuuuuuuvvvvvvvvvvvvwwwwwwwwwwwxxxxxxxxyyyyyyyzzzz{{{{{{|||||||||||}}}}}}}}~~~~~~~~~~~€€€€€‚‚‚‚‚‚‚ƒƒƒƒƒƒƒƒƒƒƒƒ„„„„„„…………††††††††††††††‡‡‡‡‡‡‡‡ˆˆˆˆˆˆˆˆˆˆˆ‰‰‰‰‰‰‰‰ŠŠŠŠŠŠŠŠ‹‹‹‹ŒŒŒŒŒŒŒŒŒŽŽŽŽŽŽŽŽŽ‘‘‘‘‘‘’’’’““““““““””””””””•••••••••––––––––————————————˜˜˜˜˜˜˜˜™™™™™™™™ššššš›››››››œœœœœœœœœžžžžžžžžžžžŸŸŸŸŸŸŸŸ      ¡¡¡¡¡¡¡¡¡¡¡¢¢¢¢¢¢¢¢£££££££¤¤¤¤¥¥¥¥¥¥¥¥¦¦¦¦¦¦¦¦§§§§§§§§¨¨¨¨¨¨¨¨©©©©©ªªªªªªªª«««««««««¬¬¬¬¬¬¬¬¬­­­­­­­­®®®®®®®®®®®®¯¯¯¯¯¯¯°°°°°°°°°°°±±±±±±²²²²²²²²²³³³³³³³³´´´´´µµµµµµµµµ¶¶¶¶¶¶¶¶¶¶¶¶········¸¸¸¸¸¸¸¸¹¹¹¹¹¹¹¹¹¹ºººººººº»»»»»»»»¼¼¼¼¼¼¼¼½½½½½½½½¾¾¾¾¿¿¿¿¿¿¿ÀÀÀÀÀÁÁÁÁÂÂÂÂÂÂÂÂÂÂÂÃÃÃÃÃÃÃÃÃÃÃÄÄÄÄÄÄÄÄÅÅÅÅÅÅÅÅÆÆÆÆÆÇÇÇÇÇÇÈÈÈÈÈÈÈÈÈÉÉÉÉÉÉÉÉÉÉÊÊÊÊÊÊÊÊËËËËËËËËËËËËËËÌÌÌÌÌÌÌÍÍÍÍÎÎÎÎÎÎÎÎÏÏÏÏÏÏÏÏÐÐÐÐÐÐÐÐÐÑÑÑÑÑÒÒÒÒÒÒÒÒÓÓÓÓÓÓÓÓÔÔÔÔÔÔÔÔÕÕÕÕÕÕÕÕÕÖÖÖÖÖÖÖÖ××××××××××ØØØØØØØØÙÙÙÙÙÙÙÙÚÚÚÚÚÚÚÚÛÛÛÛÛÛÜÜÜÜÜÜÜÜÝÝÝÝÝÝÝÝÝÝÝÝÝÝÞÞÞÞÞÞÞÞÞÞÞßßßßßßßàààààááááââââââãããããããããäääääääåååååååååååææææææææççççççççççççèèèèèèèèèéééééééééêêêêêêêëëëëëëëëììììììììííííííííîîîîïïïïðððððððððñññññññòòòòòòòòóóóóóóóóóôôôôôôõõõõõõöööööööö÷÷÷÷÷÷÷÷÷÷÷÷øøøøøøøøøøøùùùùúúúúúúúúûûûûüüüüüüüüüüüýýýýýýýþþþþþþþÿÿÿÿÿÿÿÿÿ                                                        !!!!!!""""""""###########$$$$$%%%%%%%%&&&&&&&'''''''''''((((((())))))))********++++++++++,,,,,,,,--------.........///////////0000111111111122223333344445555666667777778888888899999999:::::::;;;;;;;;;;;<<<<<<<<<<<<<<========>>>>>???????????@@@@@@@@AAAAAAAAAAAABBBBBBBBBCCCCCCCCDDDDDEEEEEEEFFFFGGGGGGGGGGGHHHHHHHHIIIIIIIIJJJJJKKKKKKKKKKLLLLLLLMMMMMMMMMMMMNNNNOOOOOOOOOOOPPPPPPPQQQQQQQQQQQRRRRRRRSSSSSSSSTTTTTTUUUUUUVVVVVVVVVVVVWWWWWWWWWWWXXXXXXXXXXXXXXYYYYYYYZZZZZZZZZZZ[[[[[[[[[\\\\\\\\\\\]]]]]]]]]^^^^^^^^____````````aaaaaaaabbbbbbbccccccccddddddddeeeeeeeeeeeeeefffffffgggghhhhhhhiiiiiiijjjjjjjjkkkkkkkkllllllllmmmmnnnnnnnoooooooopppppppppqqqqqqqqqrrrrrrrsssssssttttttttuuuuuuuuvvvvvvvwwwwwwwwxxxxxxxyyyyyyyzzzzzz{{{{||||||||}}}}}}}}~~~~~~~~~~~~~~€€€€€€‚‚‚‚‚‚‚‚‚‚ƒƒƒƒƒƒƒƒƒƒƒ„„„„„„„„„„„„„„……………………………†††††††††‡‡‡‡‡‡‡‡ˆˆˆˆˆˆˆˆˆˆˆ‰‰‰‰‰‰‰‰ŠŠŠŠŠŠŠŠ‹‹‹‹‹‹‹ŒŒŒŒŒŒŒŒŽŽŽŽŽŽŽŽŽŽŽ‘‘‘‘‘‘‘’’’’’’’’““““”””””””””•••••••–––––––––––———————˜˜˜˜˜˜˜˜™™™™™™™™™™™™™™šššššššššššš››››››››œœœœœœœœžžžžžžŸŸŸŸŸŸŸŸ         ¡¡¡¡¡¡¡¢¢¢¢¢£££££££££££¤¤¤¤¥¥¥¥¥¥¥¥¥¥¥¦¦¦¦§§§§§§§§¨¨¨¨¨¨¨¨¨¨¨©©©©ªªªªªªªªªªª««««««««¬¬¬¬¬¬¬­­­­­­­­­­­®®®®®®®®¯¯¯¯¯¯¯¯°°°°°°°°±±±±±±±±²²²²²²²²²²²²²²³³³³³³´´´´´´´´´´´µµµµµµ¶¶¶¶¶¶¶¶·······¸¸¸¸¸¸¸¸¹¹¹¹¹¹¹¹¹ººººººº»»»»¼¼¼¼¼¼¼¼½½½½½½½¾¾¾¾¾¿¿¿¿ÀÀÀÀÀÀÀÁÁÁÁÁÁÁÁÁÁÁÁÂÂÂÂÂÂÃÃÃÃÃÃÃÃÄÄÄÄÄÄÄÅÅÅÅÅÅÅÅÆÆÆÆÆÆÇÇÇÇÈÈÈÈÈÈÈÈÉÉÉÉÉÉÉÉÉÊÊÊÊÊÊÊÊËËËËËËËËÌÌÌÌÍÍÍÍÍÍÍÍÎÎÎÎÎÎÏÏÏÏÏÏÏÐÐÐÐÑÑÑÑÑÑÑÑÒÒÒÒÒÒÒÒÒÓÓÓÓÓÓÓÓÔÔÔÔÔÔÔÔÔÔÔÔÕÕÕÕÕÕÕÖÖÖÖÖÖ××××××××ØØØØØØØØÙÙÙÙÚÚÚÚÚÚÚÚÚÛÛÛÛÛÜÜÜÜÜÜÜÜÜÜÝÝÝÝÝÝÝÝÝÝÝÞÞÞÞÞÞßßßßßßßßààààààááááááááââââââãããããäääääääääååååååååæææææææçççççççççççèèèèèèèèéééééêêêêêêêêëëëëëëëëëëìììììíííííííííîîîîîîïïïïïïïïïððððððððð£€0€                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                        !"#$%&'()*+,-./0123456789:;<=>?@AB¢€0€ €è¡€0€RÀÕqSÔiš )ƒ úT¡Kc˜70)å"}H»!°&­Ø×!%‚'í,€)Â( %Ú) $ç&å&z$0#«I$(À(v"ñ ³,X0s4±3ž9 ±bH•«½íò;l>ÏÛ"Û%ð+Â.†3°6±5Û o ô" #"JØ#dj —%Ï&p"•&‡#%U#¨+C,E/Ï3?/40p.â2 6<4þ.Â1Ë60Ÿ844ª;?QA¤EÈCaA7E“>Ù>É@#E¯GZ£Y;c0i!k|k€WpQ÷NóK“OEIÑIòMêFP"MxN@J”OL‰ST§SQZ’\cb@ecüSíR¹MKƒVQT¸XÌWmZÔ_ÓYAJDÅ@<¯Dº?»>Ú;Ö:,7+6Y1¯A"=,;ƒ6Õ>ý?ÛA£:Ó?M>;Ž7YC >;á6Q3#?ÀDÄCF5.0 +÷'Ä0š1¶6«7–3-2)p(g$B,+H,u0/.å-9-Á*î+ú)$)«)J*.00‘/3431ó7À99|;I?*@Ø?7`7¶>Æ;B<= <º74¿8ß6¼9 >É7]?èA¤>Ð>¸GžJI!JQ;“>Bc<­8à6¶8;2=<; 7 ;§?w>¦@DD¶B!@‘A¶<›=Š:é;¬;¹5Ë>€3ƒ7Ï4ú8s70\-ó+Ã.S<’8X?Â8ö=nHJM”M5HþQˆQÚSYþQoQ7NsLoV»ZÙN^KåNÛS­LNšQÆUMJ¡GCÇGÇP–S\Xw[{OÏYh^%c bê]»bÁYgPlIoZooÁm.qÈtëy¢zäv­|<€¾€†~ƒ ƒ#ƒ ˆ|Œ[‰Ù}[{vçrBxªv¡x©uNwn|u€z¸tu¼yÛ{nqn6mt{•ƒ¦†½}€8ƒ«‡x†*‰Ù€I`}({>|)€k{y[„ ƒ§„ÛfƒØ€[˜€žxˆs{rîuGnøn“rjšq˜jm”oÏnìi)gyr9r!müvµf`o_[|^Òbug¡ba as^%eleøc|dxk¿n’`@]—ad` Y¨T'TNÆM›QhH§fiýk5lÕor¢pÐwFj^kmnml9fQbÙ_Èb¾\«_©\œs‰wwšx·|J{ôvyvÃw(rÕs>wRn»jpkRkke`ØcŠkèkÎf’cjp5osnke°`öb©f—]YÙW«XTNUFS OÄ_°`Ú[ºWda=\ WgS5NTßQUM¿IÆT‚Wý[=X¯]è\jV„^X![ÚOLHGF)OÓS’Q¼XXG\CÓ?,?mFØJâIOìM6S™R;:è6'5Á1{1f0z0/:):6÷3ß?§B„@šF«7¸4×/0+É.-(ï%' ”)+%\" "í'$'#–!Õ$«&V"é'£QXo[ZwúÆ£"  BTýf$R(g#ö(h+G/s& #7) +*t+½( &Ô! #( -Þ1 /Grÿÿn^¬_´³ Ä«ÖßËÿÎ_€úH÷øá ûùºz ) &«¯ø#óAôðrï.íéÅîüøþúƒþ ¿ývþ8íû°þ€J‰úÄÅ3 s¶t P tõ´Ì ž ›êí@¡¯ Î y SêÈ!G ˆš& #Ç(°¸q³!º$Ž'^&« Ëu*ƒ-˜*È(—2w5ò;: :Ì<Š9¾*ß(~,S0¸(%ê K&;*ª-í37.-þ0m(v4>9u<§@µ:þ=ø>3: ;Ž<`AÎ87BðC·@«A˜IŠL·RŠJ»=9“;«<þ4h/¼/ƒ,>;ë=Ù9¶5?´DEoI_;p87V9ô:|3Á2¶0///s1Ê.K7>/>,ÿ1i0‚)>+¸.m.#0Ó6/:·<Á=?=êB×GYLI=§?ŽDÁE¤@AA> E[H+M=L²OLPpUˆY”V1^&Z½^²c%IXH|F G‚DöC‡GÑBT?¼C CD;”6¼3K.m*¼+`&eGUKRO4PÓN2JÃP¶TjQ×TwVYj^ bsg/L¯IÑI-IÜDkE/@Þ@+GòGSL“LÒEPÆUÿVüXþZ_oc²b¤h!UƒV RóTöTaS¨WµNëW N6REQMüJ„KáKDØBíg9f5T1476j2š48>0 1¬-(‰3·8(76=I;OAh@j.X*‹+«/á+º(q*~'~)-¹&() 'ž# %Û&þ$,ß+§+ (¤)Î0n06-ˆ2À%1"›ó x&` ¾' \¥ › ÃHü<q!H/oqƒœôÈϨñ$Î(þ&&©ÜÞa5zg  " xŽA' …J±š¨ $îUF°¬ Z"Z&i"F!<!S a~ ç ¨$M¨ÿÀW• !åK§yJ!Ï& +-õ',0·043à1¹3$63J+¦*Î+f,ã%j$–4(Ê*C*Ë0x1š(¥"À D Ÿ49™<@¾A@;½8ò;;{8"7²9b;74á?®@Ÿ<Þ:'FJ{O—J‰RšO¢<Ç9½=‘BO8‡4 3~0Ñ;X>‹BãB”;6²3þ8ðGKJ HHOeTÈXU-JØIpLFJçJNëP=SOâPÙXn\B^M]4LHÔC?úIÍNºOÝS2TÏVîTk[ËYA\âA‰<:‘=º:2;p@\7­A…8Ë=»5À43û2Ü.¤,ä1Ì5C5c01,6—0d+œ)µ%€,Å+J,A0F.k,ý(ƒ(ô)£'š$#zf6$š,—-S(L$Õ1B0ª/æ'ñ#w#æ'ÿ#§E# B 1 ³ªQº¾"ÞÇ(e²¨ tò –«$É!Û%b)ƒGùA¾Ç;œhzO»Ôß;R ³[Ì+­ ƒŽ…ÿGþÆZ ¢Ùûhö:òPð3ô¦ïzíÔíñní³èÏæð õöXôIç¶ã,ãeåâàÍà¹ä"ãVçïëjêç{ñ óÉùûäú9ëóë í†ëŽíIñ¦ï#ñØôžò–òHúüýdñ4ï òæõUéêæáÚä.çDóaöîõDøu÷wòŒðRî}ñ$ñkè†æâóõÇúèý5÷ò0íÓòÎü°Ÿ1.ì_Ì L ¡  Uügû”þÿ7õ¼òüõÀí“ó&êòí¿þøP" C µX›í÷RÅV á ³ U™ Ÿ© “ ð ÿ³É°)$ƒûõ¥ý8 ? »1 K ¸×û¬ü2ûë÷öò[ð=ñâìõýý¨ø·ù Òû % k’¶ô'ï[îéìê‘êNå´åMà¶ñËñ¥ó]ðUõô?öŸñõáðRò½ò ø4ú3÷cöõêó8îìñòTê×åÁæ ã<âRß·Ý„ÙúØùé©êMì2êèîAîNé ò°ïHñKìèìÂéKäõá6ß0áÄÞ8åfàMÜÅÞÐÛõÛÈØ]ÙãÂææÄæ›ë(é¿îAîPç€èâ›áæêçð·òæøbüOûW3Þ¾ÙNØÔþ×ÁØÖfÚµÙ/ÚˆÙ¢ÔuÒ¹Þ1âóãmçÙèOëéÌð2îåòÒÍ ÉǾÍÐÑÏ2ÕøÇ<ÃHÄñÂÉËWËtÌiÐÍÑ΂ÎsÌÊoÊËÛÊ›ÅVÀ—»³»¾·<ÎnÏúË’ÌsÓØÁÜØߘÆÛÂ|Á—¿k½€¼CÃS­ÆfÅÌÃ|¿‰º­Àš¶ø¼î¸"´Ê8ÎÌ*Ï;ÓÖÚª×ÑÇ5Å%ŽƼ¿X½7·Bµ¶Å Å}ÊlÊ‚À™À`¬½‘ΆÓ•ÕÂÕÁ×;Ü­áÞYånãÝÛ¾æÔÞ²ä.סÙ¸×ä×§Ö“ÔºÏÚÎÈÓ{ØEÙ»ØÚÛÒÌõÈ=É6ÅšÎÏyќӟÓ{ÐõÍ«ÑFËæÎ ÓòÍnÓSÐÑ,Ó ØÉÛ&Ûà•á$ÝZâëâ©âã9áÿã3â“åáæ¿åèåÁì]íGðnåDä|èþí„ä{âäÜç¶ë”ðeôÔèóì‰ïóé÷lúõñÝîŒí+íLöqùªûƒýÆö”õ+ùûøžø3ùöêú¤üÈ{÷E ‹Î2 ‰é×ê £þÏú{£ú Z«”:" • · t9 Åxøöð”öíú+ôì€!‰ ]ù±ãG&H*U(¶*l/j.ø,u0›,‘/%l#¨­ ¢!B%G)©#þ6Ü¢Ä]ªTÙx  Q%ý)X.&Û!#Ž!#Ê)q*ã0¢4@4œ18ãó/‚½!æ&\'¬)Ç+µ-lð  { X(UÁÃý>üøÙ<útýÁþ$ûµüFû½ùö úXùoñÕóTþˆLvÇñõ ãþÎç o ‡…þKúzÿ8èZ,*æ Û"1#ä'„(~*+ñ-v.n€êäµÅ!³"Q&§'T*(‡/H-·1×ÄY i r " M pÝ ñ ± Æ5{_ÿ'þ÷ú¡õµô~òÏý±ýúñøõaóúÕ½¢« _ äìËH(©§DÄ c¸u«ÿ8ùæø™ööñÆíáéxú[ùRü]úQúËDyü / b ¥óý}ø¼øõbðµò7ïðítè†ãýèrßsãïßnö÷ÚùÌøSüIþàH ^ýÿHûQüú ( ¢÷ óï í ð!î*êcì„ðöèzãÌä"Þ§ßeÜéGêëÙî&åËáuä êë‡ñDôUèsé1ífå¹î(ærê¯ëˆòŸ÷Óü«üW0<wì âßÚ’w7% õ Ñœõ ú P¾„`Äw!ä¯ }œny!é% !7_!x%g)'"²&\)¶.n.25 7›5–8i4¾72;=2ô-é=RAA>å;SFfF)EÕFƒEåF‘FEFi@½>ÄAØFƒ?f=B>’=‘8Ô4œ8Q?0A«?Q:â@’;9;6Ì42l61-1K-BN@V<= E?H&Gœ782Ù2˜2ñ-¡,r&¦$¤òËg2 1²-6-ç6Ñ6Ú<0<Á@$(“#á#ˆ#›ÅÈuö#×#vñ(}-02'296XîZˆ `êön;!ˆ$5t&Œw##(=, -"('-b0Û-ÿ/É4%8Ñ<Ÿ5õ1„7²8„<·;"=@>’A¥DŒA7{5¯9[8a02/ÿ3Ö+õ=˜A{EÓH¼CìF#CšK4FÄKtOŒOæS÷TF>JGKGcI2M“HÌPQdQÏPØS8SÀX[ŽTéWÍTœWÕ[·a,b4ZyT¨SÞd§ißmþlÖihÞl¥cÿr×w[z%|Jzðxy v-z|ƒzm}Q‚p„ò…º†2ups*sq,v‘wr«r•|c|³€Úojl2oÅg;eb¹aùiŠj£hÊdÝgûj}gQize­k•jeWd[n¶p„u¼wx|bH]¬_paYYwTýWa^Ø`_[‹W‹cv`€h´[éWX-[óVýV‘R6R5TwT±SPÙQ RƒWNœTHRõM+KÕU0UYW?I¼D$B'=wA*BF>ÍEÑDÝC§CB@q;v@ƒCBG,K@kD7; G<KùN,KTJ÷I)S>UÔWOUÒZ?[÷WX/_td³fÇfæSNK$GÆPR&OKVŸL HÚDD±KËPÏU²QkYRVÎMñXÍOêUO?v:°9‡7l5ò1 7:Ø9å4i3×=ñDv0c+*"&ø'!')*º/Œ(°,ã,D. -/157³8´<Å=|0¨2m.Î/•8<A”EZGŠF\Jä*Ö'##Þ!®#&'+f#ª,V'¦p&’\!l# ‚ ®Õ19I[D‡-éÎ*fƆé®Ð [B.'0ö£ =é$ë'}&¸)(g$n+45|䃄o+Ÿ— C / àT|ü(Ož²{Sý÷µ UúãÓ€ Y¶¿yöýú?ú=ôÊôÃò Á «³@gvˆýœúøûQ ^ ?ÖUêÓ‰¬¡zþõüî Ó pü‰÷2ö½òqô ôXöû$û.÷Y÷‰³:ÿXœóÖðêºæ½ê©åÆâãÁæáéüçCâîéÆÝÙ4Ø$ÙfÔSÔ½Ú{ÕÌÔ[ÏËbÓÇÒ–ÖoÍ«ÕfÌ—ÐzÎÏÉ÷ÉtÌâÉfÎ(ÈÅÃÉÄŸÆÃÆÚÅ{ÀîÉnÂãÃd¿Ï»UÂ5Áœ½Å­¾%Ã\Ë Æ>ÍéË}ÁоÍÀÄŠ¿þ½ø¸¹Á*¶±¿)¹ë·Õ¼¼Ò¸w´.¼ì·–´?¶Æ¹§µè³d°ï¸¤¼H¾/½R´±Åµ2´!¹W¼äÂtÃh¼´¿;ÆË„Í¡Ò\ÏHÍßÊïÏçÊ/ËàÊ2Å‹ÉmË È(ñʧÎ ÍЂÔIÎ ËLÓëÏ$ÒЗÌYÐãÔ&Ó×GÛ]ÓØIÛïÙ‹àÆÞbáÿÖ-ÙïÛWÙ'ßàÛà ãDæ ç§ä¿æPêÓî;ëüÛÚmÚ¸ØíÝÝŽãNåÛ~ÞâFÜÙæ,ëÂíañšî´íàðþöžúFøïÿIêëZæÌâÅçmã[å×é×ßËÚ®ÖÀÙÈÒÕ Ñ!ãzåŠá;Ýèãëå}ðâTÞŒàÒåFܽصÚ€ݺßwÛÇ×ßÑã„áÂè½å#ì)êXÞÛÝHálÛiØiÕÙÚ–ÜPØXØ=Ýà¨ä3߯ÕÑ'Óp×ÌÈJǬÅíÑ[ÓhÑ?ÑÒ…Ö1ÚìÔWÏ’Í”Ï@ÐǡĞÂù¯À¿Üà ½iÀš½ÒÏBÐùÍÈëÑ Ö+ÐÍjÍÚÒÐ ÍÇÈ£ÐËƈκÉ–ÉuÉUÄŸÀ/ÈÌÈkÅ“ÁIÃ4Ç翹µŽ¸ž¿‹À׿…»;½“¾õ¾Ã5ÂKÃ;ÅüÅÌűÈ,È·ÀáÁ€ÆÆè¼à½¿ŠÃð¼]ÊtχÐAÓ Ô Ô/ÓYÍÔÎxÓmÔöÕöÚ¿Ù”Õ¨Þ­â˜àä®ÜóÜ ÝàTßêä8áJÚ[ÚçàšäØá™æéè†åví[ï}ó[÷òTî©ôÇòoõÅø“ö}ò—ð.ëÒòélïÁëhèýýSmþóþƒB Bþ ýsþúµû¦üMû±3 ­ ú¿Íã*9 È Ö$—T!n s ú)ZS–T—±«SV S"çE9¶dl/+„‹y"®"u"ß%}%ù*á)?!Å!kš"z&×*ú+w.içzoq\ÔÃu½i6šs “H¯ù#/? @« ÄX·füû ýøDøkòÃõh÷ƒöð4í8÷rý.þ•ûsýîœé!çtêHèNêFâŽç3âÜàêÜ8Ø7ßaã´çûã…ëûçë¶ï¬ܽØÕžØ Ú«Ö9ÞÐrÍOÌ'ÍÙÈ.ÅjÉ3Ç×ÄŠĺÄïÈÌ×ÅÂÁs¾*ÀÓ¾Z¸ß¹f½®µˆÅáÈÛÈlʶÅ‚ÄùÉoË¿¿¹» µï±B¬)ʯÎØÍÖË”ÔÏzγÓt×ìͲËïÆ÷ΉÆ–Ë ÒwÖ§Õ™Ñ)ÖûØ<ÔKÝdÕtÞ›Ú Ù¹ÙBÝÃâMÙUÙÜ}àpßÛ$á-âåÜâQâ#á<ãæ¾äkä¯àháðçéYݶÜ„Û1Üðéíèò‡öôíQéŽñyõŠùÄø°ó$þ—Äjæ g  B {°þøY÷.Cú6 :ô¶ïìôèŒì‘ðKõ—ïþîðÏõ`îˆô÷qõ¶ütú·þíäïÄïgë|ìqìÒî?èïóuóõ¨ù½öËòÜôkôðÊðÖë'ñbç[÷@÷#ø­úgú›@‰7I3÷õù)þ”ÿ>øŒu½æ ) À ”S y3òܽÿG`ý>ÅÂùó÷ó¬ñÓïÿBH»Ó¤ëûwýGNnåúi3‹;㓾!H% ÔúfFCv ‚O öÚ©E Ñ#„é‚"Ö '•+(-{0†0ú1/:+2Y6¿SÆüüþÄj$¾øËú°ª ×53Ã3Ä98:"?s.Ü2‘9V:C–=y;9T=Ä?D7¨7™;ÞAtB'>+FÞ'wÿ}¯AqJ#7­d_ò=jM°SÊF—g·•ûú¬^°kwCi'9úI€½p!@>M5ˆ'íZ»E~ùÙ¸õ/`:sBq/ª&ÒÄ}_SE3~!ë*NëD ÊÔøi±Y^¤<åäŸåë$«ç)¿„Oùw‹!ébÁ_ƒï3:¨)Ñh/€b¹ðé=,È â3-aAVÊcö¯0ˆ«Áh á‡WB_ñf0J ­oGüRõ@eçs²œË9¢[73ã°ÀñäXnÂw1–o‰~ê C8Âf,*‘yS^ÞeEÎó#¾ð¸„´UÖ û  ”¼û[é<Vù1ƒ¢€0€O‰PíKèGàJGÈTœV"UW£]m`wV«PæM÷NaH©IF=A^Ùd9edbUe=dkiæk«lŸljp¯oÜm‰mªnÁttþjˆeNea wˆ|À€~S„Â|œ„¯ˆ(ŠS‹aŒšŒ³›•ŽýŠú’+•ŒñÞ]-“Ö’¼—‹—/šò’Á‘út‰'וi”™:™¬•©žŽxŠ­ˆH…©$‘äŽk‰†í„ø†»‹ŒV}€·€ÿyŠv|xp›‡‚¨~U|{ˆˆ6ˆè|žx›{j}töpäo n+k\j¾{‘~ yÊwœ€R„™†·ˆøx›tŒtÁxft¯pUk4qUgmBh$pÚpt‘upk«gXgÐc|wˆ{kx·t~烂¥ˆg‡WŠð‹C/ƒ’è{–y˜zº~w|m{:s€ „€ˆÖ„£w†x:}¡€Lt n}jgl]eåfún|cªk0eÓI„XˆÍŒÅ…M…8Š{ˆ(Œ7ŒMt‹]Œô‘ˆ‰§‡±‡Y‰ ŒxœvPyˆlŠj`’Èu’Á˜išaøš™[šF—ò™t™+œm–—휣ŸuŒ•K”Ô™½›Ô,‰þ› #¥s¨ÉŸõšš›Ø—Ц9«8«ò°Q¬¨Ë¨¯¤¬¢d£Áž¯§È¨|¥@§i§s© ®;¥c¯º¦Ó«û­Q œ¢Þž–ó”ÿ]•~ž¥ŸÝ¥B¥¿Ÿ–©_®ª¯$²±ì¯+©{¬B¬t¨¨ «õ± ³©¸î¼v¥È¢-œÔš˜š½•ˆ‘ƒ’”£—}œç”ÍŸ¡—rœæg‰g…RƒJ„€&ió{Æz©tÒq«|ª{è‚[sbmðmêpýlOfÂee‚c+jjEesažjoeTe±aH\á]ÓbégXS…TÑVlOSPŽVxT/U\PËQkW%SˆSL>G”F´HBÍAÚE=‰DKC/@Š<‚?Û>:½7Ì;BÕ@À?‘@¹D¨IÚMRJ`=O<@âD(8&783AaEÎD<AGFrERI¡N5DÍ@gC¸@7HKÐKºOJ«JüO¸F PFóK­KýGõG†FƒBCBE“=J¦PRmP4RÊOÌJ0VãYd[_^%`&]&dú^îfËcÆXY,[0_«]\)V~TíVtY–TØWæY{YúW›U P^RX]]XGWqaW_`ƒ\3]ó[GYãX VÀUèT´O¯K˜GMM8M@PuIÚOAK7EÊH£C:DªLâI.HßE!JàP9PÈOmR˜LÒMIoI@R–V>[q[I_ncú_F¡C=u9ÝDxItIhNBNRæR½WO<Ð7¿7(87u7¹5s108@5š4Ü0Ù,é3(5—41ì.w,ì(¡11.†0ð0q/n3‰6¿/·4ì3l7+;=‹4X0ÿ3+­/ú(ƒ*ª'u;¬?sDÈEZ>r908®43ØHªMíPœT PðO•IçP×OQQM±MhNÃV_W‘\Ä_nX \{S)^4cgÖl@c_îbaãdgxd&fìk/l9pviìjÆhYhécÌ_°d _i_WbÐ_Kd9eÈf±[g[_»alVTÑOÄL7OSaØffjêmBh c¬bea|lpcosGq qŒqZm5ucjªi\jglðc—aøc3_oaî^&_ghdinÐp·eâeŸc%]ìYY¾Týq™w'z}ƒy-‚/€pxyzÖyÞ}fx½y­uúo¸us¿vÖxèmål¬jÞw5z å‚y³tY}‚[‡ç‰ Œ«‰Â‰ÈŠkiÊ‚•q…ñ†¶†‰L‚ì„hë …v‡-{òwRwÛr²‡A‹x…”wŒvˆ…(‡§Z”è“Í—–n–ž›‘²‹uŠªŠmˆB‚l€ù‹>ˆâÿykw3y‹vŽx€xÐz{|9|Œ}—rŒoÖjg–nÒsÿk/vºi¥dÎb#dƒeýif™nƒiqjnæqÎ].Z;VíT>VµRõZW7T-NÂMïVhTmPW.KEÒAÍ@aCé?ð<6Ä5=G9ØC43/3*j&/œ0v4$1L+H'$_)%Ø!Ë'A&–$&<)ß% *º-”./2ˆ3#í%¬'x)!=($ % '=)%}!_*@$‘'#ûïÚµ·¶…0*• >Z»Ø38"IÇx%n(x)* ´âó!é 2 7Ц;qç!V%5$")³-ž2ö7.+/ )@2ñ7Ê9Š9Í6ø;À:¯]:Z4÷1C4|/m+¯-(/Û2&Ø"ê Jÿ³#uŠM[ ›€ä˜À Ô$v(š#Õ,'L+pxñx ³  –Ör‚ ò †“ù( ùÂUýØeýJþíü†ûðEøEßèƒäÅ€ïé Ô» ¸õ$lÀ"°Á*õ¹FÙö'™±ø=a ò!g$¥%ç8qÞ´!–!q¹øGn  Tpþ H>ú‚¥–ƺÐîÿýæ û•ù?ù¿÷xõôõúô«ó÷yösñ&ììèçmäÙæ<àáiÞ]üSÎL~ýÝJÅÅôÿ]ú³G € E‘þ“û´ú) ²j·úéø8ó!ò"÷5ü5ÿ*ý3ïëë ëËè°ïùñò÷ñ€õ$ôøÜúÂþÆö4ø2óÑðüŒþ³ôVðGñòîæí¶ëˆîqô÷ûö»ø‹öô½þ¡d.õˆóAömô:û–ÿ…èûÿ!fôs iÀ þ-ùÆÚG2Þ(6ÊQz3  e¬´)^Ã%rœ —¿ó #d%¯$b)&V*ú)¡+‹Pˆ¢qž¯­ñ s  7yE>öÞ Ù 'éÓýÿ1ü«iWGé ( ] xDoíL´JØm°~©£ê¹^£ jÏì-{²þ· £ KÎ &ÛÊ„üY)‰ °ÉChŠ#.$¹&N'‚,ç,0}$ %P#y&”+@.-Cm?5´ Á!ÃæË&6,,Þ-Þ+—<ÙÔ_& žº+ Œ,®‘Å/Ø={Mà vê \{ Ñi #'M¹¬"åEÿ Æú½ûT£÷wÿE£þ9úøå÷PöTgß xi ]ãý ôÜVsÃõG _ é Ã=ÆG ³ Å’’`a7 ¾ Û  ½_w÷î`‹Æ"å&ÜÝ˨˜â"Î'€*ù/º&#Þ*ð";(•+‡-Ç2( *ß,¬1È5›(•)K&!ž(1Ë6Y:ó?I4ü9¨==:}A‰>ÁBEF…9ù>@DÆ<;!8]>&<“>@AE=9‰7/9Ú2/@?C1HØL†@ÅCÿF°DÂH÷GÚIxN QcVNLbKkP¤NvP®R¨WLKPNFÙOkPúUÀXŸLaHHÚC±V—[ _ád@Z™VØ_áV _cYdg¶`¼aD`“]ˆ]7]DWÖcVc"_g^¦h£]YŠWÀY#T¾R¢RdRML?KLœJNKÔJ¬RvQÊL#JýUHSåVƒUQÒOPØHC2B³BÇ?a?Œ:Ì?­BNAÖ<‰8€BžB€EÞ?<¡7ì4’/Ì4™74H0˜,å8&:x1‹.(Å$Î0l,¾.3|4ó(µ#æ Ô %1'Ý%O,ï(²-Z"tËl!8#_%z)e/Û Gî; L 3 *  ºj ýØ!5Ô!š!d!" ªñã使!žH› Op (%‚& 'þ)s)_.ê,Ð$@$!¹#"!±&ê*0.×KUWL —#Ý(ƒ)×%È!)ä"A+/}.1^1ß46œ8()+']'S'X!Ò!ž%¨k'3',-#Ø_î0ž5ó8«89K9†4=;;¬>žC:D‚A=)>•7ð:j6SE²JqN¼N&KZHGnFS@W€YLXŸ\ZÌ_ÈX[]M`àeH`'`«^]c¤^õaØgj ^`[«h lóq:uÙlŒick@dŽoµs‹r v>sv{Us‘|0wznXvSm2q-mØlÊjÈhLhÐjYi_l»jºnmkàj da—lumtoRaß\8YÒ\ZêUVRÁTXR·WŠY=TÜR8^b…TPR«VìLŸI E`B8@ P,R‘S0OÔNìI×KW“X»U'TÜ^}`&^Èc7`tdîcŠRSN½OæOÐHýG@EfFáQQ´MØM·W[ZJ[Ü[é__ `—c¹J’F~HI÷A‡@4<Á7û?.GrHÚD_@+IÆKvH±E"J E@AeD“HQ>ú:»<¬C2EæC?EÍHŒHqH ECBúF’J!Aë?œ:ø<&6~2Ê.* .\)ú&ü)+á+Ü.¥-î1ˆ"± ¡Šxb#{%“+.p%Ú ^(5 M+Ó0Ò3k0É/÷,°*i&Ú"i8“;J:Ï;ˆA Cy9‡8ò4B3ù8N30›,-*\(&&—#¾2H4 7ù9Ê6“2È1k0q-Ì,Ð+‚'ç90<æ;W>®=Ê@ÄC A@E¾CòF06M4’5¥5_6ä7ï=¹?J5Š/¬,í-¶@ÝFwIF£MÔP§NwK"VuY*^àa‹eªgœgÞP^N·SzWOJ¹EÂM"S>WiWRêV‰Q:W¤[][]]rb,^À_Y´W¯W‡Yà[]]@_§VãVfS¡XÈSAXpU¨\/^cÞf‡[oU’S½MâL„eÙkhnàrl|q×vDr|{0wg{¹€n,qPp^sþk|jlñodd%l°oBu(wÊmyh.g»l_lÅw=|à~Òƒ!~V„+…´…f{|ô}ž‹yßz"~™tûtÑpIœƒË‰,ŒKƒ³ˆR~˜Š?P”2‘A”Í’A‹ÓŒŒC‡M‡*‚Tƒ‡†Ž‚´‹^‹[‡3ˆÏ”åšV>¢Ë‚¤~b{¢{*z€|ŽGyï½}Iu{ñs¹w'yßw3x¡u}q<on{mÇ}vBO„T¶m‡VŠMAy]výr#yñˆýŽ€‹¥‘!ŽŸÓ¶’“\”I”K’ú™c˜ÕžRœ2•¸•Ôu —²”jŒ[‡…µ­ƒƒ)…–€½…—€´ƒ#ƒ%‰ˆ‰Lˆæ‹‰³P„ ŠÁ‹þ‡kˆ%r§æ“;‘*‚°~ z÷v.z¤wôyÈs™}Ò{“xÞ{÷~bq{Æ}³{ny¶ywawtq2k“idi6cÏc}_xaêa7fje‹gÎhf©eg2eä`[^ÂiÑnÍqÙq2uúu«oûxîs=w§]rXW‘Sˆ[˜[ZX’Wñ`Ýcþa‰ihdolWiÙVçTOX9\ôRNVaVHYÕ]·\IV)QCPÉbŸfÉewfwkÅoûc,aà]f[»`Æ[æYÀZ3[uWQYUæR6O«M¶K–NbS}L ]ø_úcg8bµbeÍg¤drb{défÈi`l¸nÐrMtTqìnLvssv3w#t[sem°iþld±f¶c{|8x®vH‚ƒ…vxYur½t–xM|a|ün¦lDk^l8g9bobÆ]áiÊievf;füa›`š\ë[†Y3a”]û`K`”Y TÐUQ1a÷cüiwkIcfÏkdêl&qUp˜tKt©swv˜{<kÂjieaÆi™fudßiKlòlÆpÅe“a?[ÀXZZ×U°SiOµUóTåOðX,P3U&U¨SÑSÉR>U{U["^ÐR´[ž`¥afcâ_,_‚dëgÌfLkNoâtWjànÛsu¾z+qmÞsu0zˆ{rqglsÁl'~ƒMƒv‡gˆ‹ŠôŒ-†6†¯ŒOŸƒ„Ã}le’©”™A’öÄŠŠ’‡˜‰äñ’e•‰™‡ŠU…n‹Ãƒ³‡€8‡‘K‹ú”0–Κ½šö’¹Ž?!‰áÝ¡¯¤*£È¥î¦¸©Q¥°¦Ò¬S°´Ñ¸a·x³ºõ¡^µš™˜Ò™÷œj˜ _™þ—™à—u–X’絔Њ}‘¦Œ~‰`žô¢ ¢¢#§§¨­Ÿ¯ƒµ)¡Ø¡Ìœœ˜¢Æ¦ž¨B¢æ˜;“!’}sŽÑ”7“Ú—j–*••Z‘ø›ÔŸ†$‚š°˜5“Ü“[•Ø“F–-ñ“Í‹ŒŽx¯ŒgŽ[ŒG‰j…Fㆷ’]”t—I—¶˜•˜å‘™#›Ü˜˜ÖŸ¶“½ÝŒPЉŒ¤‰Z„ªŠ#‚µ…ô‹>‡ù‚1¼ˆ¸‰á•€zxxÄ{$x™rÚq4okôiÆhCct¥rRumyòrÞuSvtrëqœt#wÃs zGu‡y'{S}|Ó~>‚’…½‚»{zí~u~&ubuo}m`hZdØfר…‚ƒ<ŠèŽirƒ«©†Š]}Mw€vû„­ˆk…r†ŠŽª‡R„«‡Œ‹ÎƒA„•… ‡D‡ ƒò„-~d|´zw]uHs­nhŠhŠ{†…Ïà”f™‹žŸ«@£½„7€Ñƒ«zæy vŒyuhw3{¬vñ{ny€ò‚~jz²}\~¹a||€.~|˜}‚:ƒê€Íˆ²wwwssn¾uusýsis·uºrÊqt*vuÏqmyñq'y¸uMkâiˆe³aåf¢j gcFhŽf¾cacÕ`"]µZ­ZÖWÙhhiKfõfªePce^f ]Z [}W“fœhödêa¼kçnZn®pea|bÎ_àa\_ofÉg5hÓh¦k’nZn•jørÙe5dÕaÑafbu\÷[IZV_Å\Þ`_UX£Zç[Œ]1^_/]Èa¶`Mb=ehëiækn5rmViqjDoþsxqvyyŽw@u±p“mO~Ï‚A€P)‡’‡Sàü}ôi“wýu‡søuA~~æy­x2ƒ$ˆ‹‹»‰¢vÝqÄnjÏrPuFs'z:n¡k7m.jïqQs}wx{‹v6xorUvCy´W€Hw›r4{Po¹ƒˆžŠ£ˆÐ‹Û‹„Ž«Ž`ÛŽx«”,–.“°˜lš•žý—ê”ɘ©ž×–—š‡‘¡¦‡©ö©7¨h§]¥”­°±/¶v¹D²2­µŽ©‚·Ï¼ÊÁÀ¼È¸¥·ñµãÆÊË"Í»ÏÍ%ǰȼÉ#ÄtÃãÉŒÄåÂ3ÃóÁ.¼p·—³G½¼‰¸>³»°š²µn¸õ¸¬D©¨Í©r£r¢[§¯§-¡†ž ˜›\—š’ݘô›«¯›­™Ä–º”m‘)’^”z—ƒ“"–”,—܈”š‘“ˆŒ“Šüˆ …ðƒ ‚•„˜¤›&Ÿu•J˜©’³˜lšwœ­¡ž¬œ™™›X+ ­–ð”ìFç‹ôšÄœ)¡º£Þ˜M˜“—š'—§™Š¤©s­_²©ý§ë¨§I«+°ª"«o®î±ƒ®Ô«æ©P¨ý¦¦2¤ª¥„¡Ã¢¡ Ê¶±¹‹·4¶f¿DÂÈ%È—ÉÊÉ¿¶'´®Ñ­¸³j¸’¹Ü¸y¼ˆ«£¦œ§%¥ ¢º¡«¼žHª ªÚ­?«‘®a°µá¸÷½ßÀMÀY±³‡°°ë¸´½¼‰Áe¬M¨Õ¤¡¢4¦uªC­§¬£Ï ¢•ŸúŸ)›K§°ªš« ªÊ°¯ƒ³f´K«£«ý§§B¬Â¬Ê¨9±Z¨0±Y¬À¢~Ÿe›„˜å“åeŠš‰Çp…>ŸJŸW¢ã¡n¡Pš™3Ÿb§‰«U©zªš°‹´z²º¦£¤ÆŸœù¥?ªÔ¡Zœ»—S–Ÿ™v•ÎŒ½ޏ’Ù‘Ô”d’`˜Ð›”˜n•Õ Ö¤’¥º§Ù¤S˜Ÿ•µ˜œ•Àšß›”Ò–\™%–ã‘q’|”^‘a•’“ûž¡¥C¥ò£ð¦© )¨¬b«L®Œ±B³´³ž¦»¥7¨J©qŸ_¤¨›Ì›îšÄšè˜å™ ˜©š¬fªQ©²Iµ¶kµ¢¸U·ˆ¸Úº‘©ï¨Lª³«œ¢QŸÐ `>«à®<ª«F²9¯©«S²Z¥" æŸ“›ã¢˜¡  Áœä¦*¤È¤G£µ¨¨ê£ ž|Ÿ™æªÙ®ÿ­d­Z´=¶2»!»ù¾_«üª*¬é¯¤8¡i£¬<®Œ«Ò©´[«õ©ž«ƒ­~£¡8 YŸÆž zœ«¬§¨(£Þ©(¥U¨«H¤¡.œ˜Ä–1–h“|§©“¯u±²"·É¹ ½ºU¸ªµ°º”µ…¶E·¹±ž°ì´Þ´ ¶ìºÛµàµm¶µ­³X¸ ·ó·ßºl¼·¼&¸ø¾Ï¸l¾M»´ê´{´²U¯|¯cª§«s·-·¿¶"·v½|½ê¿{³V±—³Q³q«š©:§±¨r¥e¦)¤¡´§¶ ²à´/»Ü½8¹ñ®¨«G«c§Ý¥¢¢l¤‰I¯f° ³Ñ¶º²E® ª®®³Ê·D¼È¿}µ°± ¬›¾môŨÂÃÞÀ±Â1»¾Eº·æµD³±ÎÊÊÍËÚʧÒìÔÌ.ËUÐ`Ò¢ÆòÆ ÄwÆíÃÆÄjÒ#ÖéÖ|×Û¥àMÕ‹ÔïÕÁÕ¼ÏiÎ.Ñ<ÈUÖ‹×;Ò ÐÛ›à|ÛèÏÖÊÎÊÞÎ<ÆŒŃÊÀ’ÇÆrÃ[¾×ÃhÂ'ÆÍÆÁÊãÅÉÃHÀŒ¼¥Ç>ÊÊ¥–À4ÂÀÆÈ+Í ϹÉ{ÅcÀ ÇÎwÓ<Ø×ÔÒ¶ÏŠËlÜAá$â®áJå{å‹ç<ç*å¸èÊèÙäWãñîò9íÜàñÜkÜjÞ"×_Ö8ØùÒ4׸ÐëÓ¯ÒVÚ]ÙîÔÞÐÊÙ ßCÕÐ`ÍèÐJѧÍVÈÌÎxÉ,ÆœÃéÁ;ű¾5Ä Á¦Å®Ħ¿Ÿ»s½]¶ëÊOÎ|ÑVÓÃÒeÕ Ñ ÓÃÑ‘ÌöÔ÷Ó˜×ïÜaÒ÷ͯÉ»ÍwÖšÚ`ÛÿÙ$×´ÛRÜÏßNÛ¼à{â8æ)êáä—àtæ„â&äç ìðç-éåèðí@í`òVòßõ†ð]ð—ë§èõ?ú/ûwýë¡çBèÎí^å·ådäüæ äœå~âüÝå ânàúâÄæßóáJáœÞÐÝ2݃ÝöÙ!ååÇäìæÁëFëþñ¼ô'ù«âàïã‰ã^ÚùØLٹٺåóèå—å)î.ñ<óòKõÝõößù¢ã~à‹äæ†Û°ØnØjäQç—äñàŒéä—ç¢åœà±Ý¢é¹î¦î>òíßñÛLÖÙÒòÜ•ßMßá²×|ÓwÓ4ϺÖÉÖÅÙÔÝ>Ù!ÕãØoÕ‚ØØ…Û Ú—Ö·ØÂÞ}ÞRÛùÝIãÌãÎâPäÜârãúØqÕøÖÃÖOÐÎÞΉÎÍyÍ Ì»×óØÍÖ×oÞ©ß™ÒÏ,ΟÌÉɬÇÄCÑЪËNÉÔÏÓ±É,ÄÄÇÁÁîʼnÊÃtÉÊÝËpÌ/ÏëÏTË ËÇ…Ã@ÊûÈÆÄòÀ<»ÆÇFÃ0¾‹¿cºÁE½-¾EÁÀ½f¼2·Ë¿®»M¼º¾¸à¸Ô´_·»±ºš½ä¿K´»²¾²e±°Y®ú®¤¿ÂV¿p¼ÝÇnÊ´ÊÏ'¿ç½fÁ&Ó¸\Á™ÄùÁܾLÉÞÈ,ÍJ̤Ã/ÀwÃôÈe»’¼¯¾Ô»Ü¿E½€ÁçÄ»Ç2ËÁÄvÆÊn̦Â#¿ ÔÅíÄaËCÏÔ ×§ÌËÌDÔ*Ø¢ÝDܸ×>ÛÖÚÞ±â¯áØæ•è¢éðêÆì”çìï›èìµg  & b £ÿ„üĉ L"ñ øÿÒ=›9:¼:ü? ?bB~8ï6Ö<˜=Â:Â9z9>g@9@ÖB–7 =ÌEs;«EgJWNÍJgNÚE…D.@‹@†; <L³JJ+FËIêGaLöG²F‰JRL¿F±G¿BÊ@C>Ý<;JVD;œC»?8;í;*5˜1À2’.Û>ó4ò,’7ë)—ò[]/az$†“,*zh“3Z'mÄo¥ÂµÎ^ZZàXÊMÕÉñ„M+Øoej a5Eו •‡ŽøOC»_¯Øh¬P­o(;Q°¼ öFnÆ!F•Œè2(kÁB#5¢ fó×Û Ñu‘Ú©é(„¥b}N&og>úÍÛ´•/&Wð6P~ʸl¤à„#Å®k‚Ákq¿3Ùspbm¨‹±Y,Ë^ðª#4 @ ²wÌËS6}¶îz-‚q°¢¾Õ›îŸ«Í•ò¦mZ†NSHÜ™“ŠùQ ¸$t}ˆS/]Aª´ÀHªåkbÉZÙÛ_ÁÌ m2¼VÛx‰™ÏiwÜ  #“&Ç´Ÿ]pr£€0€`aê’˜ ´büž#û¶ûóø‹üü=÷­÷×=üœü³ÿûÕýÕýä  }û6øûCù)õõfú³P¸x<h ®~ þÒαútûõõP¹9W;˜ Ç Ÿ ( L ù 8 : àŽ ×>«¯þûü€÷õ÷1öýù)ùúªúÏùtüUðÂîˆé*ç îbëcóãæøáÏá,ãáÝ•ܪ݈ÜHÖzÓ˜Ý Ù\âÌÙÔÔÇÏKÍMÐ#ÎŒÑÌÈÉÈÆ*ÂØ¾¸ÂοæÁ“»ƒ¾Zº¦ÄÁÁÞ¾v¿ÅŸÉ4Ì¿ÅáºP¶™´g±™²&®D¯î¨î¬Y¥K§µ¿³ºµ£³y­»«Oª¬±§Î¹¨»°¾B¿³¿®½B¹¿¸»®Ã¼OþÀU¾¿Á=ÇÈs¿¹c¶è¹»l»½®ÊTÏûÑÃÔÁÒ×Ñ[ÑPϾÏÅÎÉÏÍ!Í_ÌqÏéÑ€ÏÿÒ²ÏBÉUÑ9ËÀÊÍ‘ÎâÄdÀ”À¾½jÏÒy×ÅÚ$Ó#ÍÏÖÿÍØÙ˜ÞžÞµâ€ß­Ú‚ÚÙòÜÇÕ2ÕqÐÙqÖ¨ÖÛLÜRÒÐrÌÓÌÂÊÞŽã“æËéæ·åæâéäç¨ê{ê®ìfìþé€ðòâ™à%ÞOÝ7ÛtÖÊÒˆκˌ˴ÈEÝõÜÞ“à‰ÖÓfÑëÒfÏ€ÐÎÌ1Þ—àÃæ\ç„àOÚ´ÚÍבéÕï@ïÉò òí´î ëÚíáêÜëªë<ç¬å/ç&äÝßA܇ÞÜ Ý ëYí”ë7ì8è åèê$í%á7ÜkÜØF×±ÓàÓ“êXîKí:ðáèFçáQÝåàLÛÙÑÜúÚ;ÔžÛÊÕIÓ¥ÐÌkÐqÎ2ÊÌÌgÆÑ6ÍüÊ…ËÇÑaÔÔÿÆÂÅ=ɽqºìÃIŧÇ ðÁl¾ß¾iÌÍ«ÍBÎ[ÓKÕ(КË­Ë2ŨÁÈÌéÉyÉRÆ£ÅaÀz¼B½4Á¥¼Ù¾$»-·—³9®v®j±˜¯ë³ªáªo¥ ¢Y¡»¢C¥* Hœü—a• ‹•HÿŒ3Œý“²І”¾ˆ„2&{»ƒ#ˆ‰±‹EŽmý‘–K~¹z{µ|´v§ro4q|{ûzà ƒDzš~’}u}Þx†»‡~èÓ‚%„T„î‡!‡oŠË+Ô’j’³‘{’i—Þ›·š² “­2•ö™Y Ž/—!œ‘Ÿ£´š6•œ0“Ƙ ¡˜ ¡£n›ížŸ^¡ š¸”ñ‘Y’ŒfŒ¹“uˆÈŠŠDžŸä¥à¨ ”ŸTž¬šv¢a¨ˆ®?°½µ‡°5®×±—¶ü¹r¶ô¾Y­€¯~®a®i­'¯“´ƒ­¶õ¯‡´s¶é­n¬f°,®Á¦Å¢ÂˆC™Xµ¹1·òµR½â¼Ò·¹Ú¹3¾­¿|¶1·I°`ÂmÇâËHÉVÈ·ɦÐXÓþÖÚØ“ÖàÓù×ùÒ+Ö4ÓLÑzÓ$ÔœÓÎäÑ Ò˜Ï(ОÍeÖpÕ`ѶÓIÚ„ÞÝã¹ÌÃÈçÃÀ©ÈçÄŸÂ$½?ºø½B¾9Á…Àí¶~³ï·9µæ®Šª¥£Ÿzœ•žT»v¾êÃÅFÁœ¾5ÃêǵÊjÉ#Î)ÑÖq׾џÔ!ØdÑ€Ù•Þ¾â,å á‘æ1èáæ?í¤áÌäëã»ç;ãŸäYèèà]ÞºÜúÞ^ß¡×ÕºÏ÷ÍŽÍÕÞ/ßuå>æ§ÞIßdÛçä Ýå4á³èŽî2ï–ó7ðéöÊùöúùý9öÁì¬í˜ìnïUêê¯èRíÝè+æ§ê¨ëòá\àYÚÚÝÌìð_õi÷”ñ“õìì§÷:ûýûzþÁýmþu:÷cöŠõìøNñÆòÏíßëNæÐäjäÀòÇò ÷3øíïç@úÿ²«þûQë”4Ú V Žåwÿ£ÿ•þú$öú…P€ü‹üTø“ó¡óBó;îöéØï;òðòÀí†étôvù…ý­ªš í¶éèŸì\é"è¼ä®ãtäãÞ{Úpá›åßêXå›îzé©îò&ß9ÛU×¼ÙrÞ ÚàŠÒ²ÎÂÏ>ÍzÉPÅ9ÅóÁHÑ¥ÒtÎTÍì×ÝË[Ç5ÉeÈ£Âi½×ÀÿÌ Î¥Ì2ÎÔ\Ô}×ÙßÈ"ÅoÁªÀ¿Âi¾i¿Ê¹g¿œ»µ»l¾;¶lµ=¶û²Ðµ¯³'·å¶È±¯X·½Â#Áv®¨£¤¾¦+¦ª¦uŸÍ›ÂšÃšé™¶˜Æ“½“˜Ä”“V©;‹E‹³‡ø‡':‘‘J“p–G—G– ŽÕ“ð–§ŠŽ…ª•.™ä™:”Þš¨ˆE¡¼¥½¡¥A£h¥,§Ô£âªçŸÖß¡¿ …˜}–’¦|ª¶¬§¬¯¯±®ì°Íµ·²º¶Ÿ®0¶’º¡¹²½-¿õŵ³Ëµä´ó¸ÀºÙ¶U²T¾ öú²ð³c·«³\¯¿ªn±œ§®F©¥¹®ó®éª¥ù¯@ª¦ª¦ú¥é¢Ë¢Bªc¦¥Í¨I¦²¡çŸ» :¢Ð¢; ‡¢£ž'Ÿ3Ÿéœ¸š£žž¡á¥Åªð®ù¦—¨ªÉ¯u³Ú¸u±u¯a©†§€¢vž÷ ê²y¶x·´µ2¹Ø¾¹N¼r¾<Ã[Ç™¿5ºx¸è·´t³±…ÂýÇbËMÏãĪ¿â¾ ÉÌâÑÔ‘É‘РÔnÙ.Ý£ÑØÖÎ ØSÓPÒ>ÕÌÓìÙoÜWÍM˛NjÄÛÈïÌoÑÊßÔ ÍËÒ\Õ/ÇÃ6ÁÂÅ­ÉØ½ã»¿x¾=Ä5ÈhÊKÌÑÍËÝÇ¥Î÷ÇðÌeÓ®ÎbÕ«ÓÉ ÊÜÆýÈ ÌçÐúÔ²Ð|¾¯½Î¾ô¹ º5¹j»äºR¼Ñ¼ »ÙºøµË´6»•Á3ͳ,®'®9ª³¬Dªì§ˆ­C²8²w´²´¶ý¸å´«´¸½PÁÉÃ(ÈÀÉ5±¬ã©9¨a©Ò£ó§£ž›.¦5«¥¯ë±¬Äœ”—N“q”à–Ü—èšºŽŠ¥‰–ˆHŠ%‰,Ž'ù†b‰“’—ƒ™6—•È—,˜z—Ã’«‘ܔڎ2šo›Á–”“ÖŸO¤u [¨)•Dl‘ œã‹¯Š@ˆpŠç•¤–—›øŸõ•ú•¬•–!œ  í£¢§ÄŸÿŸúœ£ùœ8¤$ D „¡O£¡¦ã©"Ÿ`*™®Ÿ6§ª6®~­¿¦ßª ®ˆ¨B²ô·b¹'¼ »÷·h¸ïµ£·º¸Á¼EºU°…­'­z¬§t¤Ñžñœ(¯V¯ë´I´>±X²º¬Ä¸¼n»£½ ÁYÄ„ÁeÄœǨÇöÊg¹`¸¯³§³l¹w¾„¾ƒ¯¢ª³ª&­a¦$¦¦¥ ¢Nž¡Ø¤S¡I›þšuו“¤É¢‡ž>ŸY¦§¥"£9©ã™\”ו‡•?“—º’¿–…—›þœ§Ÿj¤/§£©§c¦!£Ù¢m¨ó¬M±d´h­o¨”©à¦²L¶Ð»Í»Úµ4·Ã·æ¹‘ÀÄóÇÀÇãÈ€Æ­Ê Æ÷ÉïÌÐÒUÕþÍÒã×ÝÜ-àgÖéÒÐÒ/ÔoÛ1ßJâ[æƒÝÛ'ÕñÓ¡Ô#àOâëçæßÚæ×ÄÛ]ØtëÐïúî…ï¤õ$ùÍúæü_ëüê}çAèKç]åxèøàBçRÞâàpãMßäâèâ&Û4×ÿ×ÈæWé}ì÷íÓìöêí¸ë,íhòAêÑîÿòpïœñÁõ4ø©ê×çòæNå¥ã#äkèåièËå¦ä2é èÆáÜÜ^á»Ùºí|òTôö0ö•óô‡ñ”ó¾òñõhò®ñò-ìšé@ëSëîã®àßK݆ÜÚ<Ù{Ö>ìtîjóåôäî3èœè<è÷sü»üÿyb:a¿øçø1öøù$ó°ñÚõ6ìþòíƒó‹òö‚÷híHè ãóæUùVý´É¨*üV]ýý!@~Y 6 ë È þþüÿšø÷õ´ñWÿ üqýJøôî÷üûªðcíâòXöeù$öíùEùyòlð,êÀèÍèHãßeáãhç!ì\åhïÐèÒî Ú[Ö2Ô©Ò¬Ñ|Ì DZÿS¿¯»:ÕºÔ=ΆÍ×Ýpà ÞeËJŪÄ$Ƃý%ºÐºÌÀ?¾?ÂlÂi»*ÅñÊ"È:ÊóÎÑÑÁxÀ/À-¼€¹Ð´W´h¯¿ ½´ÂJÁ›¹Õµ ±U³’­Ã¯Æú˳άÎWÏÌIЃÏ·Ñ€ÔˆÙMÛªÖIÑàÏφËËKИÈÍhÉ7Ú¿ßWäç7à ÚŠØä˜èôèöí!ä\äåšèÞ­Ý`áغäåYëGíºâàÜíåÚíó-ö úô¥ú‚ý þU©ó÷ögö°úŠódò™òoöøììÑé\ìÉãö$ùŒÿT‚ø‡óò©ñÄ²Ò yÁ…²:.`VêüµþTþ³‡w Ä &ºúúù÷º pA¤ äEG\œ¨> sÓ×Â!uBÕàƒ<C I¤…5)­ÛŒî't"'"ë&b&ü&â· vP~ ±$ž9ŽVƬ. ô; Ô à ° ¾ ©”(†") €` ` 44!=&`&v"‚'!à*ù+¬*+91]'%ä ‚ÑË‘¯àéÔ1 6î ;F×ã¡dÿAü#üBüÿjüùgöñ\îÖô‡ñ ò5ìªïéê²ð5ëÊçééWí‰ñ}èÀïIã ßÚÅØÚÝÛß;Ö_ÝâÔûØÀ×_ÙlÕŒÐ1Ϭ×yÝ ßèß©â’Ì6ÆùÄàøÃ_½â¹¦ºþ´þĈÂx¾¼ÀUÆÏÄ˹¾µÈµd²É°u°þ¬Q¬¸¸/µ·ÿ½á¾]º‹Ÿ°Š­‘¬¸¨Ì¨M¨†£¬8°o°«S§`«Æ§|¨=¥¬«Á¬µ±«µ&¬í§±§â«Â¤&² ¶Ž»¡¿â´¿±6®»*¿²Á ½¯¾ž½oÃK»ÅÿÇÄË…βʃÇjÊýÏ5ÌþË7εÔk×îÍ&̰Õ_Ú»ÝVâÚèØuÚ6ÜSÞýáÙ×ÿÕ?×[Ð÷Þà.ä·æ¶ÛÓ׃Ó£×iÏ¿ÓϾËøæ`ê©ïÏóë©çhãQç|ß]ã‹ßzð™õxõóú:ñšñ•ñóìÁìrðaç¾ïÆï„ë\ééíåðàwß©åúëêMïAïÒë»ô{ܽ×SÓËÕÕ¿ÙÖ~Ï_˃ÈòÇÇRÅÉ~ÈëÆŠÀóÀÉÌÇÊÆ:ÂÉ ½@·Ëµ°ö´µ2¹U±›¹è²$¶M·P´Ûµ·²ú·:¶»¹üº>½‹¹‹ºÕ¶H´b¿§ ¿èÆqÂȰÆȳ´‰°A«¨ª*¥[¤ã â¥&¨ù¨Ù¨à¦­o¬™§ ¥—ŸÖ¬ ¬Y§¥i°˜±á´4µ¬¤Ÿk›ƒ˜À›O—–˜¿•.—m›À—±¿ŸM»›v¥F¦ã¦Êžâ–—¶•Р­¦jžm©í”Ø-Œàˆ5ŽŒiŠÖ†¿ŒW7ޡЂ†îŒ®ü@Œm‹‹‡oˆ{Œñ‡˜„Ë‚R„€ $…¨¿„BR„;„1ˆj‹ÇƒçˆTŒ¸‡0ˆ&‹Å‘ “l’똘ȕ"™™Øž9¡7—žý¤È§ë² ‹—»”ñ¦,«‘¯’´«þª0«Ë±Ö­ó±˜´¸P®Ûª•±U³T·Ðº[®üª’«3¥É§*¡¿¢xž{¸Ï¼óƒÆ4»Ò¶Æ¶¶ðÃ(ÈZÌÐÁÈÍ8Í_ÈüÞÊÍRËöÌ/Ì­ÇqäÇ0Ê”É9ÎÒQÇrÆÈØÁdÆ1Á›½ ½¹¹bÍqÑÛщÍ@ÕùÕïÒˆÐÛyÞéáôßôæ[ÒgÏGÉ›Æ×ÇÛÂ{¾ À]¾­Á¹ž¾œ¹¸µµd°°°ëÆ\Æ`DZÆ–Ê ËsаÓ’ËÝÆÜÂÆú½bÂX½ÑóÖðÛaÚ„×XÒû×)à3ääÐäéPçáßåìæ:éŽçíèLè î(ñ¢ïÁò†÷)÷xóUûãë èÕãqàèYí‰ðrõ’ùòùåþgâ&Ýܘß´Ú“ص×{Ò΃×*ÕíÐKÙ¡ÑxÌxÉ‘Ë×Í/Ï)ÐüÄ‚Á0»òº“ÀH¾úÂé¹ÍÁ´¸‹¼‚¹ ³ê¯Í¬•²}¬Þ¶/¯ø¬a¯U³§»©O­O¦…­+¯™«K¦±²ˆ¯ ªS±s¬°¨¹¤8ŸÍ«1­m²«˜³¯%¥Q¡E€˜Ë£§¤À¢š§¿ŸŽœ0š— žÛ£Â¤%§†›—™r”&‘&œý4ŸÙ %¡Ç“Ž!‹ÀŠeŽå“³“®“„—2›a–·‹P‰а‡YɑЕ²”u”lÉ(Žk‹ñ‹mšažzL™¡  -¢`¤ýuœÀ–ï•”ŽbŒ.àˆ^…Áˆ³‡ €U “㕆’ì—(•U™—r’æ™É›¨— Ü›>š]œˆ šižI•À™Ó›tšŸ˜Ì˜B’ô˜h›î›M•¯”Çœñ™ššÅ•Q—¸’A“t‘ôŒx‹®ˆsˆû‰‹†ÑŠ.‡š„=…ë‚‘ƒiލŽ]’Õ•—Žß‹†_ŒÏ“q—¡™êžœ– –µ˜µ›nŸÇ”L–’m“~’“˜è›=Ÿš£2—’g”pŸD£.¨x¬}¡`¤ý¥×§Ž©+ªä«¬®ô¨s­?¯È´Ž¬ªb©&£ü£¬®±Pµdª «V¥Ÿ¥¯ ±w¶ºk­«¶»>¿\Ãûº(¿0¶½™Á!úÈyÀžµÆ‹ʽ¾LÀ(ÀßÁJ¶Ã"ÃÔÅÈJÍ•ѨÅŒÈúÅåƘÍ„ÒYÕÊÚ~Ñ"Îô͸ÒçÓ|ÖpØÇÝÒæÕý×ÃÜÛäÓÔFÖçÓQׄÕ`àä‰ãªçèäVàšß+ÞFÝÇÚèÙuØ'Õ ÚÓüØãÕßÔÀà«à‰áùãƒá’â¨ÝBÚå›ç^ëläÛìòæWêcÜ[×;ÕçÙÖ1Ú›ÕnÑ!Ï5ÊxÆÛͬËÓÊÆSÅÇšÁ#Ê’ÆZÃÅ@ÈÄcË;½ùº`¸§¸µ“±k³y®C·ã¶±î³º—¹R­¨±¥Ñ§K¤°¦”¡¦ž4˜º—Áž%—õ¡–³Ÿß𝙕:ãŒxeƒÓ‘;’Õ¼ˆß…Rú¡†þ†Í‰ª‚n‡6ލ‰œ‘ Ž€{Âvƒt³qÅs)uÃ{vptÕnìlyvï|{}¡|p}Ý€|œl fûe”dëd°^À\tWµ_Îe,cí^GZµeKjôlønEr9sˆu†]‡X^X‰[xVþV*UVRTWüUiU>Z}\STGQR7M/\èaçf—jÙeßj%j†f•iih¬dµlƒoKp;p)sºurvÍsb{Xl kcnäoe›b!cåq¥u,zî~sÝnÓmkó|I°…I‰÷à¸}8€€ƒ†‡õ‹”‚£}³y } u‹wç€Tuó~dy?…n†®ŒŠqƒÝ„ÿ}ÿŽ5“¥•+‘øšœ™=–Ó¡Ñ¡àž/™Š—˜Š™„š1œ_”³•¼‘´‘•ýšŽ Ž×“ªÍ“Ù‘ß‘i”þŒ÷‹r‹ O‘R‹Â‡Mƒˆ;§”‘š&«› G¡žs¡¦˜ )¤¥€¦©©½ª¨¶«B­¤-¤ãª&¬D ž›I—n‘ëŽ@¬=±B°“¬S³©° ²”± µ›´¶´jµx¹³¸Œ¸g·ƒ±˜²+²õ°b­S¨°¬÷¶‘·²´ÿµî½¦À›¾´¾¹±¥®î²´¶Ðª5¦C¤þ¤B±\´«µü¹È±›¬ ¬¼²ë³ó··à®Î«T¬§Ø¸Ì»á¸ŸººÀ½­ÂI³ƒ°+¯î²cªœ¨ƒª¿­¬¤§(£W®Sµ¦Ï¡É Æ£Äœ–›™Õš@ŸUŸÈ›ó¤z˜Q–Å›™ÿ’ÿæ‹ZŒyŸã¤+¤,¤s©[©b¨qªJ¨·©Ù«qª…¬«¦£Ë£»©©F¢!¡äœã­:²x³aµ"³Ã´Š²6³¸§¹±æ¬^«±¬ªË¼]ÁØÂêÇÅfÄõÀŒÈmÁPÆ¿¿Â½½e½ÜÁË¿ÀÃ÷ƥŊÊxº?·§»â¿1´¯‚®œ«Rª¨ª £¥¢U»Â¿ªÀºÅ;¾ ÂDÀ«¼–·™¶´¼½ ¿öÂâ· ´ ±N²­¬ð¿3ÁÊÇ>˾{¹mÁ‹µ}ǩ̴ÐÕÌÑÑèÎ ÌÆÏ É6ÎçÒrÓðØ Ð5ÐâÓåÎ$Ð¥ÑîÕ³ØwÍÊÎYÏRÕÏÙyÞæâ»Ø@ÝÓ¾ß%äåêãnâ’è?àCá“âiå!è¦ÝÝaÞrÜ[ÞsÜZÝgãŒåóë±îÿãäEáâà¨Þá¸ìãòHõªù÷òŸð%î²ï±ó­ö…÷Äû÷óvö‰òeô&ôåö¼öêïÑíÀëÏøùÚþW7û˜üÕùÂÞýÃÎç®þ,ý#ù®õþúŒýì \úØ÷¶òOñ.û"ýðÿdîýé¹êKìUæ\à·Ý]Þ±ØÙdÖè™èñäÈáxî1ï\ò‚åá˜ÛÅØöã7è³éçì ÙüÔÐæÒ=ÓÔÎ/Ë?ÊËÆCÅßËnÁŸÇ5Â[ÌNÈgÂøÁÓÈÃ¥Ã6¿A¾ƒºŒº4µˆ¿«ºF·¹¹»º_¶Û¾k²®ˆ«)§=ªÿ§§ï¢·¬­©ª¥¢¤KŸû¢¤¼œ#—j Ã¢¥ÿ¦%õš†–›Ϩµ¬>±³²öªÄ¥b£Ñ¥i  ´ãº+¾'¼Ïº”¶$ºeÃÇXÌhÌèǾÐ&Õ-Øð×RÔÆÓŒ×yÎxÖ`ÍPÑNÝ÷áØåhåèÌì™ñÈóqë·ææqêÛë"ç8ïeôFù/øôüMü ûoý- ã‘ gøñø;òñ‡ú•oõE_xîåéeåæÌá Ý×—Ö¨݉Ú¶ܸÖÚ"ÓkÕxÔλÊ–ËUÎ6ÈêÏÈ­Æ9Áû¼Ã»Ái½Æ‹¹©´‰°*°Û´N¸4½¶îÀ±º{¿`«­§¢Œ y¥¶ ¹žžžØ¡œÖ˜d•žÅ›1˜¶šþ˜W”5;‘r–W˜"•NœZ‹|‡~‡ºƒÆ‚€Éæ~¢ŒX’_•ÏŒj6•n—T“õ‹T”„‹är“—þœ®œ2—y”Œ¡=¦6©N©Ì©E®¯6³ ´+¸¸”«c®q±û°:ªØ­Ê¶ûº¡À/Á3º¼ ¹ »œÃÃÉ=ËÎËË´ÉXÑŒλÑE× Ù-ÎèÉÆ5ÇÀÙÃß_àÞsá£ç_êiì`êÁâˆãIèƒèÕâÅçTÝðìžñºôiøyò'ôc÷pö}ðî0íÑèíû7þ>úÔ÷=Âqývûñù ø"û1ûóóëòÐíé¬ìæÐæQéYå¢åÖà7â~á¢ÜkØráöç8èøêXí´ïðºõTÜy׿Ôý×€ÙÜ'ÏàÌóÌeÊ9Ç•ãÅF¾çÎeÎ8ÉȘÒÙ×÷ÒOÅIÀ9¼¡º5½¦Á¸HÂq¼`¹»°¹·Ç¼QÀÚÃeÈ’ɸ˱ÐÕÔœÓ жΫÑ:ʉÙšݯßAââ<æfê‚ï1ñyÝaÞ¼ã*âNÚÕ¼ÛœÑçåìÈì/êÝïsì%çsî§í]ìÞè è!ãÂÞÝۀܮۛÞ1àÞP×GÓ ÎkÌðÒ…Ø#Ë–Æ€Â+½ŵÆÆÉTê¿ÑÁ]Ä(¿ŽÀÆƨɺ¾k¸yÀ{µÛÈ/Í¥ÎÊÁÏŒÐãÑÏÖ?×7ÒÓØ&ÜӆΒÔaɺØ$ÜÏÞîÜTÛzØ×Û¬Ó‚ÙAÑ ÓóÑ‹ã¦æéëí>é ë=ålévìíò"óêEè¤õxú£ú—þLýÙþ¦ÿ¬þMö}ö<óGñîóÁî’ì<ìÍòIïžé·çPçXá®ß5á­àá°àâ]á%ÚZ×Ñ«ÏåØäίÉÆ`Ç¡ÆîÁ\¿å¼áºÀ¸Ó¶¿Éº¸;ÀñƃÊ:ÈÏnÍFÐö·±Ž®Ë¯°iªû«¥¨Â¢þ¡ªî°Ð¨J³9Ÿ¢š ˜=šb—+‘”Q’LakŽ¥ŠŠÃ…Y-Œ‡EŽ”‰d…`•X™O˜|–‰ž½™í™VœÂ›šà›™—Ê’÷™¦¡¥<¦ˆ©žªG©h§®ªx¤4¥*ª˜« Ù @ q®²³÷¸"·šµG¶±Õºä²}»˜·^¼CÀœÅÚÆ÷Á¼ ÅÕ»ñÉÎ-ÒLчÎ Ö¦Ú÷ààkÛmÜ2Ö˜Ý ãÝèÜíxìÃèžç‘ë@ãBéEälò0öû÷øïû°ôéôàð‚ðXôÈúþý`ìòèÇéÖæ¨ãbâ¤î[ïðñ0óÍô¹÷û¤þÜûŸïHðõ­÷øì)è]æRãé÷«Þžã ãŠÞ˜ÙÆÔ“êùï¥çÖçïÞþÙÞÐOê;â¡ç¥£¢]÷šs ï¤Û©•¥šÔ—ަ«Ê­ÿªË¤ó¡u®³@¬Ç£°…¯Ö°¤ª&©e©8£Ø¬c¯¦«¿¯!‘IŽ“’g—,™Éžg‰ðéšã–Ž ¡)›g˜&˜}žjŸT›-’í•y¡qD‘¢‹î‹KŒs’C“ŸŠæ†‹Û’É“-½Ã¿K­½£¥/¤¶¯kÈrç¨?Œ;Ã:çĤR«’Ìʽ­µ¥·ÚÖáø(¸}¯Îwã<¿Ý±“×ÜÑž ‹—€ïã¹É¤ê·€îg­+¿7ŪÓ¼àa•»—Ä”¼œë¢™ÊÆŠ,ë¼Ç"å(­éó;Ç‚Ι£üÎ?ÛÀÑœ±öû²»”ÄÓĄկxÄ™©Ó®ÙÔ†çå¼Äª'Ь¡ÇµŠ}µª éŒ.…ÜÛÑõD•ùŠ ‰™ºÆ›[œÜ8ЪÁÏè¤|¾ã—€î…;¼Ò©PöºÖ®®šÝ#Öý®•àBô¹K¢"r³¹¬i­}¼r¡Á¸ñ F‹4áN±GñôŽ«¢o®þ£€ €0€ €è¡€0€ih¦iÇmØn~6a[ê`I[g^]4TºW9W”UðXÉYØ]èZwWN]G[JY8b݇´^ÄXXŽXèV…^UYsUúYi\`hPET7S=Rbb e!l[ið^\a]Às–xù{¶z:{¶Œ(™É¡Ë¢ž‚dŠQ‡Ç†s•8§»´³½7¶X…ÿ{=„pliðdåjlzmˆws~ô„™Ý’g\:T›OUJöT×JÍPcKE-BÖ?ÉB]Oâ?e?„=65>FnT›Là`r=š< >?o<<Bé.ý;L?zGéIR6º8ó:¿7O;¯:¢HuFúGrM€?ÉCW<È0ÉIÉMDU;ZÒK<Gþ? HuAOH¨F´QÂW»SÊWäU•W»\ÐZ'ZúHlG™L!FÑEADñ=!Dp;×?>B=Â?H<ÑS¬R9MGÂXŽhis}–~qƒÁŒÈLêO_PO_NPÈTVWÅVÕWkTëUnV{QýNHO$L¤UÇOÄT`\DK KPL]P2MÐX)cœj,P¾LMÅSÊH/EA<ðAŒIÝJBJ-FåEÎKúLËMîW%SZ S*\”MÚN˜N>MuQhWîZ X>^$KúPåTÄXE°KðZw\€_ V\îføfäiðq=] ]*^ºh~\Ú`ÌZ‚g[j"kb ]ñUQ¸QóX3`,b]eiOfälzr×KúJiPLTFªGCGL@K MNSzJBNµP•UªY8J¦HNO›\M[†Z©a‰YVkÚppãy|VSSU1M”IKmK<HQX)SpV®V…]eL HÏHîK G!@ØDzB]A‚>äA2@.=;¹8Ö?*>Ú?Q@¯OâTëR‰RCXeYP2MÅP¾QM÷LMPOS¡X¿]¡L¤TáO›Yì]*d1b=_È`"dw[ÁhömUr|hìlÀtÁmnùnÒmºoÂr‘fÙhâoéeßo£l¡m7iðq—qÀrnŸou»{4i|7xF|ë|‡v*q—r#V€‚Y†8‡F€ü†¦ˆýˆ®6Žv‘Ÿ (‰‰Ž÷ŒOœ›åª²p¯ˆô€ÞyrxÜ€ñ¹†ìt…kíkamëbÝb¬b—dÛdð_Ÿc‡h~g¢hdweqhq “ƒ‡Z~Thsgeg hög„eeþ`Ì`|b^õ\0`^\:[qbp\€[ýXRR§Q™_ïab¶]Ô_(eTegd h~gµavkbygèb\^¯X¿OâcjkŠtÕoþužW¨Wk] ^KO’J‡BHNG!H¨C€X WÅWÏT‡X)Y_]QVË_nZú[6`X[·][Z©^›hör7s's‹[ Z^~_2Të[@Vh]û^ºbçhbfcsd;abbÀbÊ^eôg4^AbGgecöbÓb—`£^ºc``£cök:i‚mj£f%vÔ‚Ò›©¬Nlûnåoßmo…qsªukr7qjê_¾~…‹¯egcVb=c-\&PåT`ZV?UwZ2UnU;Ud\W`^^_TS RíR0S SZæQSTá[£Wž[ýbd1e¸gÉnErBv„g>k”liuk‹ÃФõ§”l*lÔeÕg„€yÍ”™ `_O\W\”\÷h¯lµvo~ýVhXòZŒT°X3VôUPWäW/VqT`f/av]*n=©»:ʼnÆÝÈ‚^U]ñWMÚlÞ{«„“ˆÕQPŒL6IÉT-U;uîfÅKÜHžM±M”Fï?ÉFMNSƒPŸYiT7[VËMNLôO’SHXI¢P TQDLJSQQ]RÙS QIòPÈP‚PNÊOÿ[|_´W9NèQéV{]zQßU_È]ÔVôV!TáV+\÷_OXÓNµM§OUTOÎO’PŸKÜS\S GÕM§NQLšNeR_ù]Žjt k”ÙI¬IƒHXE×JiJÍOâ@8D„CÆBÖBý<<GhA–DçEEVE~D¶CMDGßDGCí<ÛI\L LJO8KcM&IüQ†HÙC€I¢LJC“LÖQ"UwY-QVþLš[!]zeqjšXÓV?M0Uªi i–ixfjr€—ˆ®€yf”g„j†kícöd1kl_ab\ŠhöhÍmºqòeJdwbÊX)qtêxFxïrárjzã~·‚Ÿ|~ˆ†”¡—g—𙬔f™oš¯œ6œ6 ³ m–ÒÞ+Žލ+‹ë‰”†ì… „ž‹º›å„M€ü~£}ZB~?€>‚2‡‚m‚‚'€y‘„“tê‚Y‚Ç~6|†›ŽäzÚz±~…~w8k:%‚‹ƒ™€¢…‚<ƒ{…ûűë™û}È~£}‚€3y xæ{*zŠyS€ñ{ {Ý{çyS|ºƒä…˜„‰‹.‹U|°}Ÿä~6y vµwÿyÖxæzã~Ë€~JzCu:‚ŠÝŒw‘‚zÆ}–D}úw.tw¹†¦ˆéЬ£Š)ñ“v–“9–´–x•º‘Ò˜˜²™É¢“§&¨Ž«š”„”pŒ´ˆÌŸâ°­±9½œ…[Å}<~zWpNmØhl=ixm`x‚v[s½q¶uXxYxuröt!smmÎqÉmKp%o?gHbÝc`q)qƒv¢zvmoq¬v¿z0{[y­{QuDm¥wØmUhˆkÆfzÐ}È0}n{¶‰…*Œ½–Œ˜œT£¬™ñ“ÙºšÜcáæéƒìððdõ•òM÷:sŽ÷‹BI‹º‘P‘dŽkÿzM{=ygu%têut!vÔs´p¼~…€\…µˆ{v[sær‘u±ŠH“§•‡™Hš¥'«h°g”p”f˜˜:™=š7˜”™¢0®¹´¾¹F¼e– “”¬•¯ŠÔ†¦”˜²’6”£[²3Ä,Ì7Æ>ЬB‚Ç8ynEn~T}nÙzÆ}n{ xt6}n‡ïwy ~†›~"‚P‚ù‚‹†`ˆ†œˆ®Ž‘¾~ŠÝ‡еŘC›<£G¦g”fš× ³¨f©¦«¨É±ž¿­ͽÀŠ©âªO­¯Ÿ©®­—±ø²[³›±ž²¬°²R¯Ü®â·R¾EÈ(Áe­p«q§‰£R®7°þµIµà¤s <k  œ™¢–m‘–I›¤sšˆÂ‡†á‘¾”Þ˜uœ…™~ô8kzÐw_w$…f‹Š—‹öŒ‘mQ°Œ´‡'ˆ¸ˆ!ƒr}PI3”¬”¬~®|7~™~]yéx‚}Ñver`itgzŠs†LŽ$ŠèxO|7{Ôz:{¶zãn‚v¿zÚV|7€p‚ð‹Îz÷yrv«x³sÛnÈo™l=jSj]e^k0p²oÂm¥i‚s|.wsz€pbtÁrLr#xYƒ,ƒ¸‰Æq—tôu”lÞx©|ë|×r}v>t^t…uXqÝtÕptÕo¸hj·iðd–xÈ~ô~…‚Ÿ‡Û“ž¥¬Ð¬C{Ô|á°€€Q‡Û‘å”yœÂ„D‡Oƒ…†U“§ŸœŸ_©wLr}oTr°swnŸo"o…ohw.swrlÊiYiFl*dP^__‚ici©hØešmsÛ} ‰‰a…>†Ah¦iÒfžo^k€v _È`ß`?^_b¶h#h¯pãr‡]eZmY¹WÏX3XÓQ6ZæVšXèXe\€ZmUåY}WäRÐcÍyý‹ë”R“%WuRÙOtLôSX)RÆVJTKYâXò[MîMKFIPRãZ QKÑHÅC€I=E7KF@iD„MDQU;XHkvt^qüvH{ QóMÚKIƒEAH²9žDÔF•B·FxHNC&Få;LI3?[FªIòL!HXL6FÈKúLËHÅGôD3EtMŠD„KB£@ÿC“HFE->Š=hEV>:M÷9í8à=q>Å;’>ž=êNeNèIÝUåVJhØW%N¡QóTQýRíNÞQßH¼XŽY¹YB[·\&a“kÚY8UQýRÙS¶LqOUwZŒ_©cV_‚bÀh¯a]Ô^ë^_g ZPVßW%V5O8SƒXV_ï^jZÜ`?aXcœY¯][[q]GZ [ôY8bfg¢mÎqòeÕeê`Ìr‡têvÉxwõuqÉrát®lçeôbçfXd1^Ø^Y’PK³]ÊkÚ‚ð”¡%LgF;DGCÆCbEVF1?µ<ùAŒ? :¬;-@>»C0GFD AŒ>Ú>CDQG=ýL{>øC“@’L@¯A³FïGËF¾GBrL,>%C9E‡;¦BéJöG+@ÃEVCŠGÂM§PxI>OâX˜[šV?SGQßX˜YÃRÆQ"S*^¥gèqÓr×c`,Z<\M}©‹ë”*™Žs›nŸÍv›©¥Û®_´£ –žüŸˆ´•¹Ü¿ÖÃÛÀ¾å¼ŽÅƵ¬¦¸¤¦°ß¹ïÀíÃÅ¡™›”Ó–©š`šâž—ŒÑ…3yézC‡Œˆ{‚Òn´c`X˜W»lfwÃT’+RbTöQ™P¾U'cJâJ8I3OÎCãFïMNPMäJ}X cAb3k÷JiH/DQ>ÚGËOBKZW²NèTáYì`¸G5I G+NE‘E$DÀ?¿Jì<<>ÅFªH/KQÂPŸP¾TWL!O’Uw:pNÞPïN«PÒLGhEáE$C=SCC&EÄA<FÑEº@_A î>C7´9ø@CbEJ-KK'KªLàLHOÄU1T×Xy]pp¼ˆýš›T-R÷TtX\MuQ,RbSGTVQý\îaã^º] ZwV^\€iÒSÝZÒYœ\0_2[6WD]GYìZ‚Y8Wž^ë\ZmklSñR÷UÇavONKªW²UðdmZ2XòZ2_ aÙT°Zð\WÏaa9kvtàcÍi©iæiŒiŒi gHk»h#l„؈̄0‚PšB¥³°¤¯<-„…*¶~Âx‚qòm.€Ó‰C’™ž¿–Çk§fk^UXHhâmAp%Ù‰uSüX¿TLVJe!oÂkTZ–[ýa÷\”o"YVþXHX\SÊ_•]*[S[_‹] _2UTTºVKðHX?û=óSpWøXüWže5t¤ˆÕ›Ñ¦ÁYs^[q`|b—eôq\dwY¦X¿\€gR²RÙR&OGN*JìMÅJI[à\M^tVÁaím`m`dÛsd…˜‘³”3q s´uXyéoéeËd1f²ZwPùKK–K½FM±EVJ#J¦b=a^õ_dU‹RNeR9PÒSÊKðS MuTáS\N¡EAEë@AO;78àDQB]@i=†CCD¶F'D*B"BóGh<¾=à? :¢<<A‚=ËI>LôT-:¬<?H>ø<<B6@EÎF•EV>C?H?˜?HD;’FFÛJVL6H²MNL¤LTF¾FI¬LÁGéB,72JÃHøIKÇFªL­L,FïJœHbIÓNÊLÖQTjJs=6IoJìL·L OKPES3S¡QIH9JBLýPåE‘LU´OÎOT›TÄUÇJÃHãJ8G¤KFL@XeT›WÏZ Vô^ë\”gYØXò\`£RbWDWÏK2]ee^t·wic}]]ñd–Wäv d¨É‚ |.oób¢XÞWR°Æ[ÖºÙ€åºï¥ñêñSñêøù‘úø)ø÷uþ…ŽŠþõÿ©¡ûJñ™èÏîe×Û¾³«¦†™ƒ‡ {f|‡‰Nk:d']¡X¢d–o+XRYs]GcAY8VTU'SQ`?]Ô^.fU WÏTjRÆ_nYö[Ö]ÊXÞ`®R[š`ave+Z‚^ºZ‚Y¹aWÏVJ_ïdmhjýe¤mtk”n´lÀpÆnÛuør‘sÑe!h.d c‘u0Nƒ!„ä_;[­[bpWbXŽXoX)XXü]Ê_Y\v_ïY-YÍUnS¬OL·MîLC€AÜNèLTIèEºG{HÅJ#AODQEC0C0N>PŸQßQ£IòJöMDL­F'Xo]Ô[g^je¸¨’Á"TVQNÔOUPnLÁHžHNOKCW@t< KF1GhHuHNJ-JHuK³U'TöSa÷W%\»G¸K<I¬IƒMÅN„R¼LôDE°EºN4::µ:ü1sA‚AYDEÄ9“HÅG+CM>Ú@tD„=S@Î=à>ÚC@¹A>”C÷?H@ˆ=BÌAOB,I¢FïJ-GF‹CCGßKú;:¿>M>b?>AÈBóB­F´IRHlMÐKŒJiLT>±A(E`CM<G!: G™L]IyGÕM»JÍKÑLàN HãSƒI˜FD«FPC9;-E‘FúClJTKCŠDKc:eI3HžKcIƒMNMDLOÄQSM§D=WDZ‚a‰[|N«OÿMkJ’IHM:T×Kwfäo£o?mÿwÿ‡ï•ا:®ë±9³jp“rìv¢qÓklndohqƒm~r#rspínÛmÎ{f€Q‡Œˆýy†xxzŠî§Æ®ö˜˜‰˜”•~”>– ¯ð¸º¹µé¿qÔÆàèb耾³ÇiÎѰÂjºš·¡¶²¹½»WºýÓrÙ‰ÚHÖàÿìýòÏöÌö5ÞÅãuáxßÓëåðöÁò9àÞžÝÂà8×cÊ€½7»¼ÔÚáÒéñéè­¢¡›‹š–´“ž‰C•¯—š’«VK‰÷‰&‰Nƒ™°|뀗‡Fxm~6}Zv¢w’…[Ž™µ–s´p¨mUrápÏt^vHtËw.{v«y·y6}ðg„f%a¨\§gRfcL\îWäVJQhRÐS SzPŸUðOBPEQhVÁY¹UYœTVRãc-mp/lÞpøtrÍm~ua{py­u”„»Ž%™µ‘Yza°{p|¥“0¢0¯<ªærög¿cëd]e\k\&\÷X¢O›OÿZð[,cdT×NoM0PcfÙjýk”i m.sð€«€…gÓkÐg e5oév¢x €ÓqÝf¨h8hâi2jg¬^tmjpÆrÃsªr×v[k0suuzŠ}´rœp¨lµpÆ|°~£€¶€¿yà}ú|.~™ƒ ƒ¸€«…G…û‚€>|Azx½x2}„øŒ"w$ut^xFqÉs´m$t!qürÍuÏpãsÇcönnj·k»mºhÃ[·lffuh’jggŽgühØg¿o^zvzC‡ïlnïkkí{狈Œ™HbÊ\WZ©_YT-NûN>L·MÐO¹JìKÑHÏPOWkS*S3RvQC€OKRÐSpRL¤T‘Z³QýOÎR9T‡M§MÅQ,RWT7PxQY_H‰F;JE$K?ÉMÅPYQ™WbH¼IIüNÔMNMJ¦EáE›IRDÊF•I¶M0M0QÖSTQ]R&GôM0RWTëK'MÅV®V¸]eXÉfäTAN˜O¯OÄIòL{OTºIÝNNŽS—S¡JœHuF¾TöT-VhUZT`XèabføiYeša&güQIK HBSMuOT-E7E$>:>%9X< 8àLÁB CvG!LôIüD A‚@8MîLýM±RãNQMDM÷O¥HI\PÜTÍJ×K½J`N¿ELýD¡KÜH²LËJ°DÊ8†0G/u:˜?>3­LÁN PYWÅJ×N*RCJMuN4U‹YLNèMNNeWÏWø_O]4Z X3RCcöecá_‚pÙ{çˆ!„0fkgµjÖrg fkfXdðoßt6{Q{|AbÊ_‚d c7\îZÇ\a‰`ýabZæ[£]`]QdådwafahØe®gqyvŽ€èc°aÆcÍe¸dPeÕbf²d `"_‹dÇ_x`r[S] UZZ2\±WQóXƒ[SZ³\k^[dFfÙdwmØhi pvZZY]p_‹Y#SQN«Rv]z[6WÙ[š\”] aOë[QéTöTVT‘T¦[]ÔOëU[êZÇ[Á^ÄY}aÙlÀ[]]Q\€[·U]4cjÁi2mˆ\»[SW²Y8XeT`XVhOëNE-PÈJ#MaQ"QSE‘AOCÚA©E¥@¥D¡SÝV?Y’V®YˆW”Z©ZSHÅPŸOâXèTëXÉ]4cºgµkMhÃfÏegmUgRu}©xŒc‘eaXbpÏ÷“Ù¨ ²µ^³8ZÜRÆN4I¬MkQ6QLgR¼SQUPQóZ V¸YìQPïP•O›OKE°GTK2Q6TKRWX3WÙ[·YöTKR²VTöN LýEKI¿FKwFx[à[S]À[£^_Ü_´ZP_‹_•a÷d¾XRYÃO~bc°fîmuualbf[bGswv˜s'u”€*†ÍŽ÷Žq¢pøt!vŽj·iðh~hLhØf”hØcëi–cºx<zŠz§u0ÊÙ…„ˆÁ‹`‰l¢•Í“žš¦›O›O†¦…„…3‰u‚¾ƒ¤„Ùƒ¤ƒ¸‡ú~{[zvy}E|.{Ý}ÑxmVƒÌ~¹…µ‡æ•ìØ€ ƒ?¥}„ÆеŽîp¢ƒ^‚Ò†¯“9€3}1}<ƒÁ|t~·€—~Tvƒ,}P|$†¦} }‹w¥x(w¯vHySuäz:v rÍv„wõpXlÊpq¢lÞk”m`i½eeô_mõjóiÒgŽlmálµo|lÊp²l4lÔmºq=nÒs<qÓ€>i©e5^ÄZwcVcg>_ Z–WNUúS—XŽUOÎTáOUZðYVD ?¿>»3`®ddh¯rœcjmÄeêeÕf²h8mØtþŠ…>t+vHyIxÈŠ4”¬ž¡?‘Y•ì’¤’¸‹}­ ¿6ÈúÉ®ÄÕÍPÊNÚƒѹÒðÍwÑ-Úñåºë æFÇÁ˜¾Ü¼«¼ü¼H±0¯ÑÊÚÙ±âóÝ¡+•$‘öp‡ ‡m~hyÂy@~ŠH€ÊtàjgfÏdZcÄc`jIo®] QéYˆQ­n©rÍqòor{*‘P¤UªZp²n(r-w¥hÃ`ý_Ÿ`®t+vûwâ{G~®…3-‹œ‘'‘”À›‚r-o"q=n‚n(eTivŽ~]„0‚ª}cˆ®Œð“l”R”Rœß¦¢Ù±kØ’g"ŠÉ™ ª•´m¶C†Ø‚d€€Q|$z&u0t }nƒ,Žb˜l¡rqƒmØnmlÊkpnOozlŒ<”G‘“²› h#höjg˜dúh#iŒjói³hLm`iÜmÿm›r×rìƒ,ohkÚndm.dåccAf²qtËxczt·€Êz€%‚Ò„u„uƒ„&ƒgƒS‡ ¹bËœv*sðqfráu~™vzÖ·ÔÒðÝ…וo™h¯hBfŠfÅmºkWl¡hid ]e^Îc°ff²WRíR²VËKÜ?ò>XHã<@ˆ@KUwWUPQÖ[­ZY\»Y¹T-X SfTQ|U'R9UZVJK<MäEÎL{U´U;W²U;J’N*LqHãK2GÕ^ëd jImKc}nxrp²n(«T·ƒ°™k÷iml„më]Ža9mØruDpXw¹€Ž%šÎªÈy }w{¶}~Ö~…~Š{ ™[ ‹£ç¤¯§l¨À¸Lº5®K¬N§N¢íÍnÇLÛâÑ~ÆÝʼnÍÑÑLûÈZ¾(¶MÒÌK¨ mšœŸ¡¥Òš.%‘ ¢aŠƒˆ¸ƒ……x ‡F‹ë‹‹.Œ©•Ä1(1Ò/4+ë$äô3÷/ƒ07+_4¢Œn«‘ ‘Ò‰&‡ ß‘'œ+ŒE~ô®s´ª»¹¶X· ´YÄþ½œ°Ö¹ Ÿ°Gß;BE›B·CŠ6°H“BéRRDûBSNoþT‘Sƒ7'LP(MŠ\”LËCWaQTjiXb¢hiƒþWä_Yu±…Ól«†Ø‹`yIr‘„&tqk±ƒ¤~ý˜~“%hLz¼‚ù“u… ‚¾ši7”¡³¹…˜TÄoÕE›L6j·o†¯q_£¡n(eÁ’ÖFÈT›hLfÙ‰auž£¢‹ˆ‹iªæ‰l¡™Žä”Šf¨À»¼©ˆš.”™ ’…–•©ˆŠèj’?š}ŸjKvoŽä{Ê‹œ¯d‰»’»%¼—5¿+½#±íµ­’¿­¹•Áe¶/¯ð¤~»¦,¸¦Á¡^Øä0€ €¡€0€¤€strand¢€ €¡€0€ €¡€¡€0€0€ €¡€ ¢€¡€£€0€ €0€ €B@¡€^<¿¢€ŠÑ£€mw¡€0€ €B@¡€sù#¢€ÿ]䣀‚#¢€0€ €B@¡€^+¼¢€>›£€m죀0€ €B@¡€sè ¢€ÿ®£€‚ ˜¤€0€ €B@¡€ùð¢€ÛUÙ£€Ãó7¥€0€ €B@¡€¬ƒ¢€×(죀Øõ㦀0€ €B@¡€ùߢ€Û ££€Ãõ¬§€0€ €B@¡€›€¢€Öܶ£€ØøX0€ €¡€0€¤€helix¢€ €¡€0€ €¡€¡€0€0€ €¡€¢€¡€¢€0€ €0€ €B@¡€1ލ¢€‚]P£€ã`¡€0€ €B@¡€• h¢€ë£€çТ€0€ €¡€0€ €¡€0€¤€strand¢€ €¡€0€ €¡€¡€0€0€ €¡€&¢€+¡€£€0€ €0€ €B@¡€¬Ã“¢€-T£€r¡€0€ €B@¡€®ŸR¢€,D£€¨ Ö¢€0€ €B@¡€¬| ¢€-9›£€a飀0€ €B@¡€®WÌ¢€R£€¨§¤€0€ €B@¡€ä¢€z¥£€÷v¥€0€ €B@¡€¿Ú¢€fõ\£€$Ʀ€0€ €B@¡€œ•¢€z³£€÷eÙ§€0€ €B@¡€xT¢€fÚj£€—0€ €¡€0€¤€strand¢€ €¡€0€ €¡€¡€0€0€ €¡€/¢€2¡€£€0€ €0€ €B@¡€’FD¢€¤†£€ïh ¡€0€ €B@¡€t‹’¢€ÿwm£€é쨢€0€ €B@¡€’<-¢€ñ⣀ïc×£€0€ €B@¡€t{¢€ÿÄÉ£€éèu¤€0€ €B@¡€¬ 좀ÿ•v£€f»Â¥€0€ €B@¡€ŽQ:¢€ûh]£€a@`¦€0€ €B@¡€¬Õ¢€ÿâÒ£€f·§€0€ €B@¡€ŽG#¢€ûµ¹£€a<-0€ €¡€0€¤€strand¢€ €¡€0€ €¡€¡€0€0€ €¡€E¢€H¡€£€0€ €0€ €B@¡€§«‹¢€"nn£€9+ü¡€0€ €B@¡€»Î¢€7D£€C@¢€0€ €B@¡€§æ¢€"D+£€9ú£€0€ €B@¡€»ÊÄ¢€7Á£€C#¤€0€ €B@¡€œ.#¢€mÛ£€³îœ¥€0€ €B@¡€°f¢€‚°œ£€¾µ¦€0€ €B@¡€œi¢€m°Ã£€³Ñš§€0€ €B@¡€°M\¢€‚†Y£€½å³0€ €¡€0€¤€strand¢€ €¡€0€ €¡€¡€0€0€ €¡€I¢€L¡€£€0€ €0€ €B@¡€£’_¢€ž”.£€Þh¡€0€ €B@¡€œ|Ò¢€¶£€ðˆÑ¢€0€ €B@¡€£L­¢€žsÿ£€Þw£€0€ €B@¡€œ7 ¢€µõÑ£€ð—P¤€0€ €B@¡€ÝЇ¢€Umž£€T ×¥€0€ €B@¡€Öºú¢€lïp£€f*¦€0€ €B@¡€ÝŠÕ¢€UMo£€TV§€0€ €B@¡€ÖuH¢€lÏA£€f8˜0€ €¡€0€¤€helix¢€ €¡€0€ €¡€¡€0€0€ €¡€M¢€Y¡€¢€0€ €0€ €B@¡€$äx¢€0AÈ£€ùpØ¡€0€ €B@¡€ÐbТ€FØ£€d9 ¢€0€ €¡€0€ € ¡€0€¤€strand¢€ €¡€0€ €¡€¡€0€0€ €¡€[¢€b¡€£€0€ €0€ €B@¡€8ƒ¢€N¡£€º–ã¡€0€ €B@¡€õXy¢€ìN£€Ò˜ð¢€0€ €B@¡€ÿ廉€a¡£€º‚£€0€ €B@¡€õœ¢€ÿN£€Ò„¤€0€ €B@¡€ì°ƒ¢€õa£€û‹¥€0€ €B@¡€áÐy¢€åŸ£€’˜¦€0€ €B@¡€ìg¦¢€õa£€û{·§€0€ €B@¡€ᇜ¢€å²£€}Ä0€ € ¡€0€¤€strand¢€ €¡€0€ €¡€¡€0€0€ €¡€d¢€g¡€£€0€ €0€ €B@¡€Ù"±¢€•Q£€b0¡€0€ €B@¡€Ȥö¢€†ÏN£€ù20¢€0€ €B@¡€Ù颀••a£€JŸ£€0€ €B@¡€ȇ.¢€‡”£€ùŸ¤€0€ €B@¡€Nîñ¢€¥G £€§Ä¨¥€0€ €B@¡€>q6¢€–Å>£€’”¨¦€0€ €B@¡€NÑ)¢€¥‹Q£€§­§€0€ €B@¡€>Sn¢€— „£€’}0€ € ¡€0€¤€strand¢€ €¡€0€ €¡€¡€0€0€ €¡€p¢€s¡€£€0€ €0€ €B@¡€Úÿ¢€Ì]”£€tD¡€0€ €B@¡€Ãüh¢€ÞX(£€kf_¢€0€ €B@¡€ÚÍg¢€Ì3'£€tnð£€0€ €B@¡€Ãʾ¢€Þ-»£€k‘;¤€0€ €B@¡€ï±¢€ÿT£€Óo\¥€0€ €B@¡€Ø¢€&ù裀Ê‘§¦€0€ €B@¡€î⢀Ô磀Óš8§€0€ €B@¡€×ß^¢€&Ï{£€ʼƒ0€ € ¡€0€¤€strand¢€ €¡€0€ €¡€¡€0€0€ €¡€w¢€z¡€£€0€ €0€ €B@¡€į¢€q™L£€¦,m¡€0€ €B@¡€ÊŸ£¢€xÝ £€‰"k¢€0€ €B@¡€Äç좀qc¶£€¦*¤£€0€ €B@¡€ÊØu¢€x§s£€‰ ¢¤€0€ €B@¡€l¿b¢€¹Ä£€}4%¥€0€ €B@¡€r¯ë¢€ý£€`*#¦€0€ €B@¡€lø4¢€„.£€}2\§€0€ €B@¡€rè½¢€Ç룀`(Z0€ € ¡€0€¤€strand¢€ €¡€0€ €¡€¡€0€0€ €¡€{¢€¡€£€0€ €0€ €B@¡€r»{¢€o£€Š¿¡€0€ €B@¡€~Ë¢€îél£€–-¢€0€ €B@¡€rúÔ¢€%„£€‰Ó’£€0€ €B@¡€~¿$¢€î𣀖`¤€0€ €B@¡€½dâ€frߣ€z¯¥€0€ €B@¡€É)¢€M=Û£€¦€0€ €B@¡€½¤¢€fyô£€M‚§€0€ €B@¡€Éhl¢€MD𣀠Ùð0€ €¡€0€¤€strand¢€ €¡€0€ €¡€¡€0€0€ €¡€‚¢€…¡€£€0€ €0€ €B@¡€©@碀EcÌ£€;1Y¡€0€ €B@¡€ŽR¢€G𙣀HëF¢€0€ €B@¡€©/}¢€E¡¦£€;飀0€ €B@¡€Ž袀GØs£€H¾Ö¤€0€ €B@¡€iaW¢€ãâÝ£€Ìi¥€0€ €B@¡€N6¢€æª£€Ú;V¦€0€ €B@¡€iOí¢€ä ·£€ÌTù§€0€ €B@¡€N%X¢€æW„£€Úæ0€ €¡€0€¤€helix¢€ €¡€0€ €¡€¡€0€0€ €¡€™¢€ ¡€¢€0€ €0€ €B@¡€Š H¢€@ £€¼*0¡€0€ €B@¡€ëv0¢€$p £€¹–¢€0€ €¡€0€ €¡€0€¤€strand¢€ €¡€0€ €¡€¡€0€0€ €¡€¥¢€¨¡€£€0€ €0€ €B@¡€I¢€„ü™£€†Æï¡€0€ €B@¡€ý‘¢€k¢w£€xˆÙ¢€0€ €B@¡€‘ž¢€„ߨ£€†Êö£€0€ €B@¡€ýO¢€k…¶£€xŒà¤€0€ €B@¡€è‡æ¢€Ka£€2Ç¥€0€ €B@¡€ßEa¢€1º?£€òô±¦€0€ €B@¡€èÐn¢€J÷ £€6Χ€0€ €B@¡€ß颀1~£€òø¸0€ €¡€0€¤€helix¢€ €¡€0€ €¡€¡€0€0€ €¡€­¢€½¡€¢€0€ €0€ €B@¡€V=H¢€gÅ£€â´‡¡€0€ €B@¡€RH¢€Å𣀀1È¢€0€ €¡€0€ €¡€0€¤€strand¢€ €¡€0€ €¡€¡€0€0€ €¡€À¢€Å¡€£€0€ €0€ €B@¡€à„(¢€‹ZS£€Æ—¯¡€0€ €B@¡€Ã×¢€Š×¯£€Îq袀0€ €B@¡€àvÈ¢€‹—ࣀÆiw£€0€ €B@¡€Âúw¢€‹<£€ÎC°¤€0€ €B@¡€±]Ø¢€ôÏC£€ Ã¥€0€ €B@¡€“ᇢ€ôLŸ£€Ȧ€0€ €B@¡€±Px¢€õ У€ •W§€0€ €B@¡€“Ô'¢€ôŠ,£€o0€ €¡€0€¤€helix¢€ €¡€0€ €¡€¡€0€0€ €¡€Ì¢€Õ¡€¢€0€ €0€ €B@¡€Ïˆ¢€­3Ø£€DÀ¡€0€ €B@¡€K ¢€`-£€f- ¢€0€ €¡€0€ €¡€0€¤€strand¢€ €¡€0€ €¡€¡€0€0€ €¡€䢀é¡€£€0€ €0€ €B@¡€²´\¢€R¹t£€ßÞÒ¡€0€ €B@¡€–í¢€Q_$£€ìp[¢€0€ €B@¡€²©b¢€S£€ßδ£€0€ €B@¡€–⣢€QªË£€ì`=¤€0€ €B@¡€Uœ¢€4£€ ¶R¥€0€ €B@¡€9ÉÝ¢€§ä£€GÛ¦€0€ €B@¡€U…¢¢€MÛ£€ ¦4§€0€ €B@¡€9¾ã¢€ó‹£€7½0€ €¡€0€¤€strand¢€ €¡€0€ €¡€¡€0€0€ €¡€û¢€ÿ¡€£€0€ €0€ €B@¡€B ú¢€Ô2£€¤Æí¡€0€ €B@¡€-ˆ¢€)Mq£€±È¥¢€0€ €B@¡€BA¢€ n£€¤Éj£€0€ €B@¡€-½5¢€)†­£€±Ë"¤€0€ €B@¡€ +J¢€R/‚£€øVe¥€0€ €B@¡€õ§h¢€d¨Á£€X¦€0€ €B@¡€ `h¢€Rh¾£€øXâ§€0€ €B@¡€õ܆¢€dáý£€Zš0€ €¡€0€¤€helix¢€ €¡€0€ €¡€¡€0€0€ €¡€¢€ ¡€¢€0€ €0€ €B@¡€‡ø¢€&¬¨£€Eð¡€0€ €B@¡€׌ˆ¢€”ÐУ€½Cp¢€0€ €¡€0€ €¡€0€¤€strand¢€ €¡€0€ €¡€¡€0€0€ €¡€#¢€'¡€£€0€ €0€ €B@¡€êýb¢€S`Ý£€­¡€0€ €B@¡€çœÈ¢€@ e£€v!ÿ¢€0€ €B@¡€ê³é¢€SyŠ£€uࣀ0€ €B@¡€çSO¢€@#£€v2¤€0€ €B@¡€,{¢€ãTm£€ åÍ¥€0€ €B@¡€)g¢€Ïýõ£€õˆ¦€0€ €B@¡€,1ˆ¢€ãm£€ ܧ€0€ €B@¡€(ÐТ£€õ~R0€ €¡€0€¤€helix¢€ €¡€0€ €¡€¡€0€0€ €¡€>¢€J¡€¢€0€ €0€ €B@¡€Ó㢀?p€£€?Ý¡€0€ €B@¡€%¸@¢€{8£€E`¢€0€ €¡€0€ €¡€0€¤€strand¢€ €¡€0€ €¡€¡€0€0€ €¡€N¢€W¡€£€0€ €0€ €B@¡€ì*¢€Ä(G£€z«¡€0€ €B@¡€GB¢€»s£€Œ Ö¢€0€ €B@¡€ì&Ž¢€Ãࣀyÿ £€0€ €B@¡€C¢€»*Ø£€‹ì4¤€0€ €B@¡€Ô¢€2_£€Fì ¥€0€ €B@¡€ñ¢€)L£€XÙ6¦€0€ €B@¡€ÐM¢€1¹5£€FÎi§€0€ €B@¡€ì΢€)ð£€X»”0€ €¡€0€¤€strand¢€ €¡€0€ €¡€¡€0€0€ €¡€Z¢€]¡€£€0€ €0€ €B@¡€Ò•¢€Ù±¦£€żǡ€0€ €B@¡€Ò¦”¢€ò(÷£€³~¢€0€ €B@¡€ÒO ¢€Ù”¨£€ŗᣀ0€ €B@¡€Òå ¢€ò ù£€³\˜¤€0€ €B@¡€|À½¢€—Æ£€i¢§¥€0€ €B@¡€}V¼¢€¯’£€Wg^¦€0€ €B@¡€|ÿ3¢€–ýÈ£€i}Á§€0€ €B@¡€}•2¢€¯u£€WBx0€ €¡€0€¤€strand¢€ €¡€0€ €¡€¡€0€0€ €¡€`¢€c¡€£€0€ €0€ €B@¡€my좀™Û£€¨gë¡€0€ €B@¡€v6l¢€‘]w£€ŒV„¢€0€ €B@¡€mŠC¢€™Úh£€¨W;£€0€ €B@¡€vF‑¨£€ŒEÔ¤€0€ €B@¡€ç`ô¢€ˆtó£€ÓX¥€0€ €B@¡€ðt¢€€B£€·F´¦€0€ €B@¡€çqK¢€ˆ¿€£€ÓGk§€0€ €B@¡€ð-Ë¢€€£€·60€ €¡€0€¤€strand¢€ €¡€0€ €¡€¡€0€0€ €¡€s¢€v¡€£€0€ €0€ €B@¡€}Ñ¢€ij£€Â_¡€0€ €B@¡€a’@¢€„ªE£€É4X¢€0€ €B@¡€}ß/¢€ÓÊ£€Âa·£€0€ €B@¡€a _¢€„¹\£€É°¤€0€ €B@¡€Lº¨¢€­c£€¯«‡¥€0€ €B@¡€0{Ø¢€’õ£€¶É€¦€0€ €B@¡€LÈÇ¢€¼z£€¯öß§€0€ €B@¡€0‰÷¢€¢ £€·Ø0€ €¡€0€¤€strand¢€ €¡€0€ €¡€¡€0€0€ €¡€x¢€{¡€£€0€ €0€ €B@¡€ „©¢€åaŠ£€Õ븡€0€ €B@¡€ðþ+¢€ÕFw£€Ñg0€ €B@¡€ t¢€åX£€Õ­1£€0€ €B@¡€ðí–¢€ÕrE£€Ñ)g¤€0€ €B@¡€T$Q¢€ˆlª£€GÀ¥€0€ €B@¡€:Ó¢€xQ—£€|Ãö¦€0€ €B@¡€T¼¢€ˆ˜x£€ 9§€0€ €B@¡€:>¢€x}e£€|…o0€ €¡€0€¤€strand¢€ €¡€0€ €¡€¡€0€0€ €¡€}¢€€¡€£€0€ €0€ €B@¡€A&墀>× £€d º¡€0€ €B@¡€-¾{¢€?k0£€L€r¢€0€ €B@¡€AÔ¢€>‹o£€d£€0€ €B@¡€-®j¢€?–£€L‹Õ¤€0€ €B@¡€àm¢€_¥y£€´ã ¥€0€ €B@¡€̧¢€`9 £€W¦€0€ €B@¡€ßÿ\¢€_Yߣ€´îm§€0€ €B@¡€Ì–ò¢€_c%0€ €¡€0€¤€helix¢€ €¡€0€ €¡€¡€0€0€ €¡€…¢€‘¡€¢€0€ €0€ €B@¡€Т€x˜£€Êþ8¡€0€ €B@¡€tºÐ¢€µžh£€ß¢€0€ €¡€0€ € ¡€0€¤€strand¢€ €¡€0€ €¡€¡€0€0€ €¡€•¢€œ¡€£€0€ €0€ €B@¡€ÿq‡Ê¢€U7Û£€Å¢¡€0€ €B@¡€ÿi¥m¢€p•{£€Ïù:¢€0€ €B@¡€ÿqÈ$¢€UW£€Äâ%£€0€ €B@¡€ÿiåÇ¢€p´¤£€ÏÙ½¤€0€ €B@¡€þˮ¢€”D{£€°tÂ¥€0€ €B@¡€þÃÌe¢€¯¢£€»lZ¦€0€ €B@¡€þË”c¤£€°UE§€0€ €B@¡€þÄ ¿¢€¯ÁD£€»LÝ0€ €!¡€0€¤€strand¢€ €¡€0€ €¡€¡€0€0€ €¡€Ÿ¢€¦¡€£€0€ €0€ €B@¡€ÿÿ#¢€‘-Û£€€)¨¡€0€ €B@¡€ÿ7ð8¢€Ÿõ룀yÙw¢€0€ €B@¡€ÿÚi¢€‘r4£€€2È£€0€ €B@¡€ÿ7Ë~¢€ :D£€yâ—¤€0€ €B@¡€ÿo[C¢€z+£€ÌÕ¸¥€0€ €B@¡€‰LX¢€ŸB;£€Æ…‡¦€0€ €B@¡€ÿo6‰¢€¾„£€ÌÞØ§€0€ €B@¡€‰'ž¢€Ÿ†”£€ÆŽ§0€ €"¡€0€¤€strand¢€ €¡€0€ €¡€¡€0€0€ €¡€¨¢€¯¡€£€0€ €0€ €B@¡€¢Å7¢€ͦ:£€ËȰ¡€0€ €B@¡€¾,)¢€Ùp9£€ÅX=¢€0€ €B@¡€¢äX¢€Í^–£€ËÊ£€0€ €B@¡€¾KJ¢€Ù(•£€ÅY¤€0€ €B@¡€ÿ^Ÿç¢€©|j£€g•0¥€0€ €B@¡€ÿzÙ¢€µFi£€a$½¦€0€ €B@¡€ÿ^¿¢€©4Æ£€g–‚§€0€ €B@¡€ÿz%ú¢€´þÅ£€a&0€ €#¡€0€¤€strand¢€ €¡€0€ €¡€¡€0€0€ €¡€²¢€º¡€£€0€ €0€ €B@¡€ÿÞ°¢€¯5£€*O¡€0€ €B@¡€ÿ& ¢€LÁ£€'È ¢€0€ €B@¡€ÿ碀üΣ€*KŸ£€0€ €B@¡€ÿ& q¢€šZ£€'Å;¤€0€ €B@¡€ÿ%¢€'$Í£€xçD¥€0€ €B@¡€ÿCTi¢€#ÂY£€v`ঀ0€ €B@¡€ÿ%#x¢€'rf£€xãß§€0€ €B@¡€ÿC\Ñ¢€$ò£€v]{0€ €$¡€0€¤€strand¢€ €¡€0€ €¡€¡€0€0€ €¡€¾¢€ဣ€0€ €0€ €B@¡€ÿ&º¢€…¼|£€ÑI›¡€0€ €B@¡€“!ž¢€u¿D£€áê3¢€0€ €B@¡€ÿ~ûó¢€…{û£€Ñ>ü£€0€ €B@¡€’ö×¢€u~ã€áß”¤€0€ €B@¡€ô¼J¢€V~¼£€Ó¥€0€ €B@¡€·-¢€F„£€'1k¦€0€ €B@¡€ô‘ƒ¢€V>;£€†4§€0€ €B@¡€Œf¢€FA£€'&Ì0€ €%¡€0€¤€strand¢€ €¡€0€ €¡€¡€0€0€ €¡€Ç¢€Ë¡€£€0€ €0€ €B@¡€1Z†¢€Cô›£€·j¡€0€ €B@¡€BY/¢€*¥Š£€ ¢€0€ €B@¡€1ް¢€Dõ£€‡£€0€ €B@¡€BY¢€*Å䣀íµ¤€0€ €B@¡€Œþ¢€ˆÝ;£€•Ê:¥€0€ €B@¡€§¢€oŽ*£€—0Ù¦€0€ €B@¡€ŒM(¢€ˆý•£€•™æ§€0€ €B@¡€KÑ¢€o®„£€—…0€ €&¡€0€¤€strand¢€ €¡€0€ €¡€¡€0€0€ €¡€Ì¢€С€£€0€ €0€ €B@¡€Z¾3¢€š7⣀£ Ö¡€0€ €B@¡€M:œ¢€µ5£€žŒµ¢€0€ €B@¡€[³¢€šX!£€¢þŠ£€0€ €B@¡€M€¢€µUM£€ž}i¤€0€ €B@¡€EJ¢€p‹ê£€é¼n¥€0€ €B@¡€7Æl¢€‹‰£€å;M¦€0€ €B@¡€Eƒ¢€p¬)£€é­"§€0€ €B@¡€8 좀‹©U£€å,0€ €'¡€0€¤€strand¢€ €¡€0€ €¡€¡€0€0€ €¡€Ñ¢€Ö¡€£€0€ €0€ €B@¡€ëí¢€{í²£€ì0O¡€0€ €B@¡€/¢€z¹¼£€±/¢€0€ €B@¡€ë|;ã€ì2À£€0€ €B@¡€ƒ¢€{Í£€³ ¤€0€ €B@¡€ÿ2ºô¢€{"’£€•€¥€0€ €B@¡€ÿGO¢€y€¬ï¦€0€ €B@¡€ÿ2¼Ù¢€{p££€•‚€§€0€ €B@¡€ÿGPí¢€z<­£€¬`0€ €(¡€0€¤€strand¢€ €¡€0€ €¡€¡€0€0€ €¡€Ù¢€á¡€£€0€ €0€ €B@¡€ÿ1ú˜¢€gtq£€£#¡€0€ €B@¡€ÿ!e¢€NÊ£€¢Û+¢€0€ €B@¡€ÿ1¼l¢€gõ£€£t£€0€ €B@¡€ÿ Ú9¢€N2N£€¢Ä|¤€0€ €B@¡€@¢€,–!£€5g ¥€0€ €B@¡€ÿ: ¢€*z£€5&¦€0€ €B@¡€Þ¢€,¿¥£€5P\§€0€ €B@¡€ÿ~ûᢀSþ£€5d0€ €)¡€0€¤€strand¢€ €¡€0€ €¡€¡€0€0€ €¡€梀ì¡€£€0€ €0€ €B@¡€ÎÞ䢀Ûž £€„KÔ¡€0€ €B@¡€²g‘¢€ÑM£€ˆ“¢€0€ €B@¡€Îú`¢€ÛUo£€„Tœ£€0€ €B@¡€²ƒ ¢€Ñö£€ˆ'[¤€0€ €B@¡€è7,¢€ ¾Y£€ÂÖ´¥€0€ €B@¡€˿٢€mࣀÆ©s¦€0€ €B@¡€èR¨¢€ u¿£€Âß|§€0€ €B@¡€ËÛU¢€%F£€Ʋ;¡€1€ €0€ €1€®€0€ €1XD1¡€A¢€¡€0€ €Ô¡€ ¢€«€w·&¡€1€´€0€ €¡€0€ €Ô¡€ ¢€¡€ Hydrolase¢€0€¬Acarbose Rearrangement Mechanism Implied By The Kinetic And Structural Analysis Of Human Pancreatic Alpha-Amylase In Complex With Analogues And Their Elongated Counterparts£€0€–Mol_id: 1; Organism_scientific: Homo Sapiens; Organism_common: Human; Gene: Amy2a; Expression_system: Pichia Pastoris; Expression_system_common: Fungi¶€0€¢€0€ € Homo sapiens¡€human£€1€0€ €taxon¡€ €%†¥€0€ € €0€ €Homo¡€sapiens£€{Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Primates; Catarrhini; Hominidae; Homo¤€¥€¦€PRI¢€0€ € ¡€ ¢€𦀡€A‚ðXYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL¢€0€ €0€¡€0€ € ¡€ ¢€ £€0€ €'¡€ˆ¢€ˆ£€ˆ¤€'¢€0€ € ¡€ ¢€ £€0€ €'¡€ˆ¢€ˆ£€ˆ¤€'£€0€ €¡€ ¢€ £€0€ €'¡€ˆ¢€ˆ£€ˆ¤€'¤€0€ €¡€ ¢€ £€0€ €'¡€ˆ¢€ˆ£€ˆ¤€'¥€0€ €¡€ ¢€ £€0€ €'¡€ˆ¢€ˆ£€ˆ¤€'¦€0€ €¡€ ¢€ £€0€ €'¡€ˆ¢€ˆ£€ˆ¤€'§€0€ €¡€ ¢€ £€0€ €'¡€#(¢€#(£€'¤€'¨€0€ €¡€ ¢€ £€0€ €'¡€ˆ¢€ˆ£€ˆ¤€'©€0€ €¡€ ¢€ £€0€ €'¡€ˆ¢€ˆ£€ˆ¤€'ª€«€0€ €'¡€$T¢€|£€ô¤€'¬€­€0€ €'¡€¢€£€¤€'®€'¯€'°€ ±€в€ ¸³€ ¸´€FPµ€N ¶€ˆ·€0€ €¡€ ¢€ £€¤€¸€0€ €¡€ ¢€ £€¤€¹€£€0€¡€0€ € 144.832997321497¡€ 0.610865238198015¢€ 0£€ 0¤€ 66.8453775444417¥€ 226.062143490789¦€0€ € -0.90945690870285¡€ -0.34763291478157¢€ 0.228046953678131£€ 0¤€ -0.300930976867676¥€ 0.928874731063843¦€ 0.215850412845612§€ 0¨€ -0.286867707967758©€ 0.127680152654648ª€ -0.949388325214386«€ 0¬€ 30.6286678314209­€ -30.0230922698975®€ 39.5395927429199¯€ 1§€0€ € 8.40183269230769¡€ 28.5713588942308¢€ 50.161119951923